SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009160 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009160
Domain Number 1 Region: 87-158
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000303
Family Fibronectin type I module 0.091
Further Details:      
 
Domain Number 2 Region: 26-91
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000753
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 3 Region: 192-235
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000327
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009160   Gene: ENSGACG00000006901   Transcript: ENSGACT00000009180
Sequence length 336
Comment pep:novel group:BROADS1:groupXX:7730114:7731875:1 gene:ENSGACG00000006901 transcript:ENSGACT00000009180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFSHNLPKLVSALFINSPIWSQVCPRRCQCPKEPPECLPGVPLMLDDCMCCLVCARQRGQ
VCSDMNPCDTRKGLQCEYTVHGRTGICAAHKGEACVLGGSVYQNGQTFFPSCKYQCVCRD
GQTACVPRCNLDVMLPGPDCPMPRRVQVPGECCEKWVCEPQAEASALGGFAMAAYRREET
VSFDGWDPSLNCIEQTTEWGACSQTCGTGVSTRVSNKNRMCEMVKQSRLCTIRPCDNQPD
QTQLTQLAQKRGSKCQRMVRSDAAVHLSYKNCTSVQAYKPRYCGSCTDGRCCTPHRTKTA
LVEFRCAKGKTTRRPVMVILTCACHSHCPSDNAVWQ
Download sequence
Identical sequences G3NUZ1
ENSGACP00000009160 ENSGACP00000009160 69293.ENSGACP00000009160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]