SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009161 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009161
Domain Number 1 Region: 572-633
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000115
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 500-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000379
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 3 Region: 31-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000112
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 627-684
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000025
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009161
Domain Number - Region: 452-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000902
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 84-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00834
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009161   Gene: ENSGACG00000006905   Transcript: ENSGACT00000009181
Sequence length 855
Comment pep:novel group:BROADS1:groupXIII:5768682:5775531:1 gene:ENSGACG00000006905 transcript:ENSGACT00000009181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDSLSIAQLCSAALPWLLFLLARPGFCYQRVHCQWGPYGEWSECDGCTRLMTRSRAMAVY
AQFGGNPCGGGRTETRPCEITQGCPLDDGCGDRFRCRSVFPPAGKCISKSLVCNGDQDCE
EDGHDERDCDMDKHVVCQKSVPPPNIEQLGRGFDVVSGQRRGPVINTKSFGGQCRVIYSG
VHGALYRLPLSTTQFSFMVKAQSDFSDEMYTSKWQYAKDIVNRATVTGTTTGYDNYDFHE
TQLQTQTHKLLVLKSDIEVAQFQSNSPQYLPLSEEFWKALVKLPSVYDYAAYRKVLQMFG
THYLSEGSLGGSLEIIAKIDEETQRQMVNTLHDYNECERTKRWILIFPIYHVKCKSGKHG
TGTHSDTSTSNSVNKVNVLGGGIQHIAALKGMQLSNPERNWEMFSNWAESVRTFPDVTKQ
TLRPVSELVKEVQCAGVKRLYLRKAIEQYLAESDTCHCRPCSNNGLVVMAGDECKCICKP
GTSGLACEHGIQVQGQQGVIDGSWTCWSAWSSCSGGRRSRRRTCSNPSPRNGGQNCIGEP
TEASDCEDQNLQYLKTMEPQCFDQTLPASQMCGDPPVLINGYIRVPLDIYIVGSRVEYTC
TDRFYLVGTSILECTANQTWSSSPGLCTVSRCSVLSLSEDVIASPSQQNYGIGQTVTLSC
PEGRQLLGEPTIICDSSLHFSPDPSDIKCSPACMDVSHVDNTELQCEPWEKFHKGKCVCK
MPFECSSSVEVCATSPVSRKSVLLNVCKMHALQCMGSIHTIAEDSACTWLKLSTTGCTNC
HMWETCDDQTNTCRCKDSADCLNPGINVCVKVGETVTPVTQNMSECETGLRRCKGEKVSV
VSIQPCTAEDAGLTV
Download sequence
Identical sequences G3NUZ2
ENSGACP00000009161 ENSGACP00000009161 69293.ENSGACP00000009161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]