SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009368 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009368
Domain Number 1 Region: 414-697
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.57e-69
Family Protein kinases, catalytic subunit 0.000000517
Further Details:      
 
Domain Number 2 Region: 253-340
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-34
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 9-98
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-20
Family I set domains 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009368
Domain Number - Region: 145-204
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00288
Family Frizzled cysteine-rich domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009368   Gene: ENSGACG00000007064   Transcript: ENSGACT00000009388
Sequence length 901
Comment pep:novel group:BROADS1:groupVIII:7826645:7851507:1 gene:ENSGACG00000007064 transcript:ENSGACT00000009388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFIRLEAPMNNITTSLGHTADLLCRVSGNPQPSVRWLKNDAPVVQEPRRISHRSMPYGSR
LRIRNLDTTDTGYFQCVASNTQGTVSTTGVLFVKFDPLPTLLAGRPTEDFDEEGFCQPYR
GIACARFIGNRSIFVDSFQMQGEIETQITAAFTMIGSSNHLSDRCSQFAIPSLCHFAFPT
CDRSSGSDRPRDLCKDECEILENDLCKTEYIIARSNPLILKRLKLPNCEDLAAFDSPEAA
NCLRIGIPMAEPINKNHKCFNNSGTDYRGTVSVTKSGRQCQPWNSQYPHSHTYLAIRYAE
LNGGHSYCRNPGNKLEAPWCFTLDEGVRMEICDIPVCDHKEKSGGSNMEILYILVPSVAI
PLAIALLFFFICVCRNNQKSPRPPAPRQPKPVRGQNVEMSMLTTAYKPKSKAKELPLSAV
RFMEELGECTLGKIYKGHLYLPGMDQAQLVAIKTLKDISNPQQWVDFQQEAAVLTELQHP
HVVCLLGVVIQEQPVCMLFEFLPLGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFL
HMSIQVAAGMEYLASHFYTHKDLAARNILVGEQLQIKISDLGLSRAIYSSDYYCLQPKTL
LPIRWMPPEAIAYGKFTSDSDIWSFGVVLWEIFSYGLQPYYGFSNQEVMEMVRKRQLLTC
PEDCPPRFYGLMTECWQEGPTRRTRFKDIHLRLRAWEGLSSHASSSTPSGGGGNATTQTT
SLSASPVSNLSNPRYAAAAAAAAGYLYPAQAIASPGQMGPIQAWTPMAVTQTHQRFIPVN
GYPIPPGYAAFPAHFPPAQPTRVVQHHLPPPKSRSPSSASGSTSTGHVSGVHSTTGSNHD
ANTPLLSHCIMPGSSGGAVQVYGQVGQKGVGQLDHASQKALLAADSDALMYNDSSVITAG
L
Download sequence
Identical sequences G3NVJ9
ENSGACP00000009368 ENSGACP00000009368 69293.ENSGACP00000009368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]