SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009373 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009373
Domain Number 1 Region: 15-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-32
Family Spermadhesin, CUB domain 0.000049
Further Details:      
 
Domain Number 2 Region: 130-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000479
Family EGF-type module 0.0015
Further Details:      
 
Domain Number 3 Region: 177-209
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000017
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009373   Gene: ENSGACG00000007078   Transcript: ENSGACT00000009393
Sequence length 210
Comment pep:novel group:BROADS1:groupXII:9128574:9130606:1 gene:ENSGACG00000007078 transcript:ENSGACT00000009393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVLFSLMHTSLSVEMTGLYGSFTSPDFPRPYPDNQLKVWNITVPDGHRVKLYFSHFSME
PSDQCEYDYIQVSAEGNETLRYCGEEEKNYDGSPRKTTMLSAGNLVSVVFRSDYSNEGRF
TGFQAFYAAEDINECLTQIDGERVCDHFCHNYIGSYYCTCRQGYLLHDNKRSCTVPCPSQ
VLTSPSGVLTSPGYPSHYPPMSQCDHTIRL
Download sequence
Identical sequences G3NVK4
ENSGACP00000009373 69293.ENSGACP00000009373 ENSGACP00000009373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]