SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009467 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009467
Domain Number 1 Region: 58-92
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000005
Family GLA-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009467   Gene: ENSGACG00000007152   Transcript: ENSGACT00000009487
Sequence length 95
Comment pep:novel group:BROADS1:groupXI:3837872:3838760:-1 gene:ENSGACG00000007152 transcript:ENSGACT00000009487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLAVLLLCSLAVICLTSDAATASQPDSPAQEGLFVERQQASAVARQRRAAGQLSLTQL
ESLTEVCEANLACEDMMDTHGIIAAYTAYYGPVPY
Download sequence
Identical sequences G3NVU8
ENSGACP00000009467 69293.ENSGACP00000009467 ENSGACP00000009467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]