SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009473 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009473
Domain Number 1 Region: 69-104
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000000883
Family GLA-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009473   Gene: ENSGACG00000007157   Transcript: ENSGACT00000009493
Sequence length 117
Comment pep:novel group:BROADS1:groupXI:3841627:3842385:-1 gene:ENSGACG00000007157 transcript:ENSGACT00000009493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLLQLLALCAAASFCVCYDSHESTESVEDLFVAPNQANSFMAPQMGSVYVPARGNGHS
YYNFMRKVKSPAERRAETCEDYSPCRFYAYRHGFQQAFQRYFGARNPPQRPAVTRRY
Download sequence
Identical sequences G3NVV4
ENSGACP00000009473 69293.ENSGACP00000009473 ENSGACP00000009473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]