SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009555 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009555
Domain Number 1 Region: 13-116
Classification Level Classification E-value
Superfamily PH domain-like 6.94e-27
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009555   Gene: ENSGACG00000007217   Transcript: ENSGACT00000009575
Sequence length 133
Comment pep:novel group:BROADS1:groupV:9427298:9428558:-1 gene:ENSGACG00000007217 transcript:ENSGACT00000009575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIHERIVSYFESCTSQVDKEGFLHKKGERKTSYQKRWFVLKGNLLFYKDRPADRDVTGV
IVLEGCTVQLCESEEQFAFSLVWGEPGLRTYKFAAEDQAGQESWIKALLSANHSYLALLV
MDLEKKYRGDLQE
Download sequence
Identical sequences G3NW36
ENSGACP00000009555 69293.ENSGACP00000009555 ENSGACP00000009555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]