SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009666 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009666
Domain Number 1 Region: 9-317
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-78
Family Protein kinases, catalytic subunit 0.000000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009666   Gene: ENSGACG00000007292   Transcript: ENSGACT00000009686
Sequence length 619
Comment pep:novel group:BROADS1:groupXIII:6495513:6503900:-1 gene:ENSGACG00000007292 transcript:ENSGACT00000009686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQDVFLHGFDLGGHFVDLRPLGTGVTGVVLSAVDQRSGQRVAIKKLAMRDAVAVKHAL
REVKITRRLHHENVVSVHEVLAPYGQPLPGDPSQLSALYIVQECMETDLARLLEQGPLTT
GHATLLFYQLLRGLKFIHSANVLHRDLKPANIFINTDQLLLKVGDFGLARIVDPHYSHKG
YLSEGLVTKWYCSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGGHELEQMQLILD
TVPVLREEDRQDLLQVMPSYVSHGWRVKKPFSELLPELDAQAVDFLERILTFNPMDRLTA
EAALSHPFLREYSCPEDEPTSSHPFRIEDELENGLVTGQSLSSSQASSIHWERYKNSLST
DVSWQLSMERCRCMPSDLGDTTEDEEVQRDPRASTTSLSEEAQVDPRKYSHSSSAERFLE
HSHSSLERACGLAHGELDCGRSCDYKVGSPSYLDKIAWREGKPQHYSEPRLILDLSHWKR
NTSSLPVPAELFQEISRWVESTQFRLHSPQSQSEPRLPSCFTSSPPLPISPTDPPAPVFH
HAQVMRQPFPLPSRSPQTASPPTSPLFPSPESQPLSSTSTVSQPAEDDSSESLPVQQRQR
LFDLDVFISRALKLCRQNK
Download sequence
Identical sequences G3NWE7
69293.ENSGACP00000009666 ENSGACP00000009666 ENSGACP00000009666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]