SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009680 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009680
Domain Number 1 Region: 275-321
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000017
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 326-380
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 379-435
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000111
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Domain Number 4 Region: 439-486
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 898-1079,1112-1200
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000833
Family Rhodopsin-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009680
Domain Number - Region: 505-539
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000109
Family Hormone receptor domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009680   Gene: ENSGACG00000007293   Transcript: ENSGACT00000009700
Sequence length 1469
Comment pep:novel group:BROADS1:groupX:10477197:10572975:1 gene:ENSGACG00000007293 transcript:ENSGACT00000009700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAQQCSSLVAGVLYGSFSLRELFPSRAAGCSWSLENPDPTKYSLYLRFTRQPVICRTHS
PMLLSLDHHLANQSCPLHLHEAAPKDQEVIDLCGSQSNSEAPYSFLQFDKNFVQICLTRH
PAEDALQVSKDLLELRLVEVLLINNENSSQFTCGVLCRWFEECLRTGHNGDRGLSDADGC
AMTQTGCICPNHNIMAPPIPLLPETPHSPSNALSPDAPTFEADAVLHQPDSTSLFVSTAD
GEGGNPYDEDDLKVKTQRPRSADQPGVFQAQTGDPAAEEWSQWSVCSLTCGQGWQVRTRS
CVSSPYGTLCSGALRETRMCNNTATCPVHGLWEEWSLWSLCSVTCGRGSRTRTRKCVKEG
VAVACGRPEIQTKLCNIAVCPVEGQWLEWGLWSRCSVTCNTGSEQRQRRCSASVHGWAEC
KGPHQESRECTNPSCSGGGNWGNWNHWSLCSKTCDSGSQRRFRMCEGSGLQGYQCDGSGE
EVRSCNEKKCPAPHEICKEEHLLSMSWKRASAGETVYNKCPTNTTGSASRRCMLDNNGVA
FWGPPSFARCVSFEYRHLHVSLREHLAKGQRTLAGEGMSQIVRSLLELLQRRSYYSGDLL
FSTEILRNVTDTFKRATYIPATDDVQKFFQVLSLMLDMENLEKWEDAHQVTPGAALLMRI
IEDFIHLIGEAQKPFQSFLVVTSNLMITVQREPVSAVSSDINFPMKGRRGMKDWARTAED
KLYIPKEVFVTPAEGKQDKYGCQIIHCPIRIHHLAPLPPASHTERTETETEAEPESPMYY
VIGAILYRTLGVILPAPNLPAVINSKILTVTIRPELQPSKPMVVVELAPLFNGTSDPQCV
VWDYGNPEAGAENWGTEGCQTLASTTVHTKCLCSRISTYAVLAQQAKDPDMGPTSMPSLP
LMVGCGVSCTALLILLLIYAAFWSRYIRSERSIILVNFCLSILASNLLILVGQSQTLSKG
LCTVTAAFLHFFFLASFCWVLTEAWQSYLAVLGKMRSRLIRKRFLCLGWGLPALVVAVSV
GFTRARGYGTASYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIVVFNKLMSRDGISDKSKK
QRAGSLSVPAEARSRLLLKCSKCGVISSTALSSSTASSAMASLWSSCVVLPLLALTWMSA
VLAITDRRSTLFQVLFAVFDSVQGFVIITVHCAMRREVQDAVRCRMGGCKDDSENSPDSC
KNGQVQIMTDFEKDVDLACQTVIFKEVNTCNPATITGTLSRISLDEEDDPKLASHQEGGV
GVNPPTTFCPRKRPWPGVRGQASQHRQWTTLRSPLPPRPLTLHPAENEAYPADFVPSSVG
EMNIAMNLNRSYGTIKTMPHGHSHVMAPGGLVHSHGGHMHPHGHSLQLKPGQRPSVRQIL
TGGTTVERTRTLPRNLGSTNANSGLSAGSLERKRVRYSELDFEKVMHTRKRHSELYHELN
HSSKFHTIDRYSRDPAMSTFKVRPLSKGG
Download sequence
Identical sequences G3NWG1
ENSGACP00000009680 69293.ENSGACP00000009680 ENSGACP00000009680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]