SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009851 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009851
Domain Number 1 Region: 74-583
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.41e-193
Family Myeloperoxidase-like 0.000000000000152
Further Details:      
 
Domain Number 2 Region: 34-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000044
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009851   Gene: ENSGACG00000007384   Transcript: ENSGACT00000009872
Sequence length 620
Comment pep:novel group:BROADS1:groupVIII:8446071:8450585:1 gene:ENSGACG00000007384 transcript:ENSGACT00000009872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIKTSSNKVWNMNRFALAVFLLAIGFLVAEGGNPCCSEPCQNRGVCTALGADNYECDCT
RTGFHGHNCTTPEFLTWVKISLKPSPNTVHYILTHFKGFWNIVNNISFLRDAIMRYVLTS
RSHLIDSPPTYNADYGYKNWEAYSNLSYYTRTLPPVPEDCPTPMGVVGKKELPDAKLLAE
KLLMRRQFIPDPQGSSLMFAFFAQHFTHQFFKSDMKKGPAFTVAKGHGVDLSHVYGDSLE
RQHKLRLLKDGKLKYQILDGEVYPPTVKEVGAEMHYPPHVPDSHRFAVGHEAFGLVPGLM
MYATIWLREHNRVCDVLKEVHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYNFKL
KFDPELLFNQRFQYQNRIASEFNTLYHWHPLMPDSFHIEEKDYSYKEFVFNTSLVPEHGI
GNLVESFTKQIAGRVAGGRNVPGPIMYVAIKSIENSRKMRYQSLNAYRKRFSMKPYSSFE
DITGEKEMAAILEEFYGHVDAVELYPGLLVEKPRTDAIFGETMVEMGAPFSLKGLMGNPI
CSPEYWKPSTFGGSVGFNIVNTASLQRLVCSNVQGPCPTAAFNVPDVKDTGSRIINSSNS
HSRGSDINPTVILKERNSEL
Download sequence
Identical sequences G3NWY2
69293.ENSGACP00000009851 ENSGACP00000009851 ENSGACP00000009851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]