SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009891 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009891
Domain Number 1 Region: 417-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000628
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 2 Region: 300-434
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000014
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 4-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000011
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 232-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000145
Family EGF-type module 0.034
Further Details:      
 
Domain Number 5 Region: 271-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000189
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009891   Gene: ENSGACG00000007444   Transcript: ENSGACT00000009913
Sequence length 661
Comment pep:novel group:BROADS1:groupI:5694625:5711351:-1 gene:ENSGACG00000007444 transcript:ENSGACT00000009913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFFTDPCASSPCLHGNCSRSDLGGAVEPAYTCECTEGYEGERCDQILLDLPAAEWEPAAP
SAPEPATPVAPTTTAATQPPQTTTVSSTTAPPVPTLQPWQPRPGQRVLVVPWEAERVTEG
LHCVSPELCELTSGTLTLSLEVPEETAVKVVVNVSGAPVLWCVNEEGFLRSSILNGTTLQ
FLQAPDGLVVPDRSLPLGQNYFLGKLSPIQAYAYVTLRLNLTVKASSCVEPGSSFSDPQC
SGKGKCITQPSESTFFCECEDGYTGIFCEEFDACHRRPCHSNGTCTDVRQGGEGRNFTCT
CPPGYEGERCQLLVDHCLSQPCKNGATCFSSLAGPRCYCPEGYQGATCEQKVDPCASGPC
HNNGTCYAQGPGPLGFGCSCTAGFTGPTCAQLVDFCALNPCAHGVCRSVGNSYRCLCVPG
YHGLYCEEEYNECLSAPCQNYATCRDLINAYECVCTSQFDGIHCEIYKDPCLKMHCQNGG
HCESAGLNNSCVCPPGYLGEQCEVDINECESNPCHHGGTCVDQSNSFTCHCPPGWVGPSC
EIHLQWKQAHTEDTLTNMPRHSLYIIIGALCVAFVLMLIILIVGICRISRIEYQGSSRHA
YQEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDATPIAYEDYSPDDKPLVTLIKTKD
L
Download sequence
Identical sequences G3NX22
ENSGACP00000009891 69293.ENSGACP00000009891 ENSGACP00000009891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]