SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009897 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009897
Domain Number 1 Region: 290-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-55
Family SPRY domain 0.0000364
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-18
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 87-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000366
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009897
Domain Number - Region: 130-241
Classification Level Classification E-value
Superfamily Tropomyosin 0.00144
Family Tropomyosin 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009897   Gene: ENSGACG00000007462   Transcript: ENSGACT00000009919
Sequence length 475
Comment pep:novel group:BROADS1:groupXVII:6323739:6343965:-1 gene:ENSGACG00000007462 transcript:ENSGACT00000009919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACCLKDELLCSICLSIYQDPVSFGCEHYFCRKCITEHWSRQELHGVRDCPECRRTFTDP
LLSPSLKLSNIVERYSAFPLDAILNAQRSSYPCKDHEKVKLFCLTDKSLVCFFCDEPALH
EQHQVTTIDEAYEEIQREMKEQLATLQDSEKGHTEALQLLQRQLTETKSSAKSLRATIGD
AFERLHRFLRERQKSMLEELETDTARKLADIEHKIQRYSQQLRDVKEGIQILQERLNETE
RHDFLEGIAVTSERIKGKIHETNLTYEDFPTSKYMGPLQYTIWKSLFQDISPVPVALTLD
PITAHQRLILSDDCTIVAYGNLHPQPLQDSPRRFDVEVSVLGAEGFMSGVHYWEVMVSEK
TQWMIGVAHETVSRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVKSKLEKVGVYL
DYHKGLLIFYNADDMSWLYTYREKFPAKVFPYFSPGQSHANGKNVQPLRINTVRL
Download sequence
Identical sequences G3NX28
ENSGACP00000009897 ENSGACP00000009897 69293.ENSGACP00000009897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]