SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009988 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009988
Domain Number 1 Region: 738-866
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000455
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 378-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 674-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000373
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 4 Region: 493-529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000742
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 5 Region: 636-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000019
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 6 Region: 342-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000108
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 7 Region: 416-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 8 Region: 454-577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 301-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000709
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 600-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000746
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009988
Domain Number - Region: 190-344
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0455
Family Growth factor receptor domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009988   Gene: ENSGACG00000007522   Transcript: ENSGACT00000010010
Sequence length 1248
Comment pep:novel group:BROADS1:groupXVIII:6376331:6408970:-1 gene:ENSGACG00000007522 transcript:ENSGACT00000010010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNRTRIRNCFPIACLLLTLWTEKVSQSTGYFELQLITVANVNGELADGDCCDGPRSSSD
LRCTRDECDTYFKICLKEFQMEVSTGGACTFGDGSTQVLGGNTFSFKSTTSNPNKIDEAG
KILIPFQFAWPRMYTLIVEARDWDNTTRNIGDELLIERSIHTGMINPGDQWQTILHDGPV
ARLVYRIRVRCNDNYYSNKCNKLCVPRDDYFGHYRCEPSGARVCLDGWMGSDCRKAICKQ
GCNLLHGNCSVPGECKCNYGWQGQFCDECVLYPGCVHGTCNSKWQCNCERNWGGLLCDKD
LNYCGRHQPCVNGGTCMNTEPDEFHCACPPGYSGKTCQIADHACVSNPCANGGRCHEVPS
GFECQCPPGWEGPTCADNLDECASGPCAKGGTCIDLEDGFECVCPPQWEGKTCQIDANEC
AGKPCVNAFACKNFIGGYYCNCFRGWSGQNCDINLNGCHGQCQNGGTCKEDQRGHHCQCP
PGFVGSHCEIRKNKCDSSPCQNAGQCHAVLDGFVCQCPPQFAGQLCEINGWTPSDACDPN
PCENEAECYSMDEDFYCACPEGFEGKTCERLKENCQTAPCQVIDSCTIAVATNDSAGVRH
ISSNVCGPQGRCISQPEGNFTCMCDLGFSGIYCHENINDCIDNRCGNGGTCIDGVNSFQC
FCPDGWEGQLCDLNVDECRHNPCKNGGRCVDLVNDFYCQCADSWKGKTCHSRESQCDATT
CSNGGTCYDHGDAFRCACPPGWGGNTCNTARNSTCASGPCSNGGTCVGGGDTFTCICKEG
WEGPTCGQNINDCSPHPCYNGGICVDGVNWFRCECAPGFAGPDCRININECQSSPCAYGA
TCVDEINGFRCICPLGRTGARCQEFIGFGRTCHYAGLQFPHGSQWEEECNSCHCINGKAD
CTKVLCGRRSCVLPSSAQDPKQQTCPAGQECLEHRYLTCFSPPCQQWGVCSRAGPSSPEA
STKCQPNTGHLDNSCGRITLVFNRDKVPQGTTVQNICYELRYLPDTRSLAKDHALLLLCA
LSHSNQDAVEVAISFQPEDLPDHSLIQQAASAIVGTLSKRHNSTIMLAVVEVKVETQVMA
PSVVDYRVPLLCVLFCLLCLFCIIVCVWWTRKRRKERERNSRPAADDNVNNQWQPLRLVV
GRQQQQQQQLLKESNRDAEQERRKLMGPSYRTCDEGEETEGELELEDECGGAEAGKQVYK
YSKTAVQSSGEVICTMHSSSSPLKDPHRTPGYSPKDNRWKNGLRDHCV
Download sequence
Identical sequences G3NXB9
ENSGACP00000009988 69293.ENSGACP00000009988 ENSGACP00000009988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]