SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010002 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010002
Domain Number 1 Region: 1238-1503
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-53
Family YWTD domain 0.00000214
Further Details:      
 
Domain Number 2 Region: 1858-2094
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-44
Family YWTD domain 0.0000168
Further Details:      
 
Domain Number 3 Region: 2993-3248
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-42
Family YWTD domain 0.0000202
Further Details:      
 
Domain Number 4 Region: 511-750
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-42
Family YWTD domain 0.0000081
Further Details:      
 
Domain Number 5 Region: 1553-1807
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-39
Family YWTD domain 0.0000479
Further Details:      
 
Domain Number 6 Region: 2166-2433
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-34
Family YWTD domain 0.0000776
Further Details:      
 
Domain Number 7 Region: 226-443
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-32
Family YWTD domain 0.0000983
Further Details:      
 
Domain Number 8 Region: 3889-4154
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-30
Family YWTD domain 0.0000655
Further Details:      
 
Domain Number 9 Region: 47-62,91-164,448-495
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 10 Region: 3748-3864,4146-4213
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000424
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 2915-2985,3241-3302
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000895
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 12 Region: 858-901
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 13 Region: 900-941
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 14 Region: 1152-1232,1503-1547
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000267
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 15 Region: 2737-2773
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 3330-3374
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 3455-3491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 18 Region: 944-980
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 822-860
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 20 Region: 3413-3449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 21 Region: 2868-2909
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 22 Region: 3573-3610
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 23 Region: 2658-2694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 3612-3656
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 1029-1067
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 26 Region: 3533-3568
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 27 Region: 1813-1862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000441
Family EGF-type module 0.011
Further Details:      
 
Domain Number 28 Region: 3372-3409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 3490-3530
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 30 Region: 983-1016
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.00031
Further Details:      
 
Domain Number 31 Region: 3293-3327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 32 Region: 1-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 33 Region: 2781-2814
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 2817-2857
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 35 Region: 2697-2734
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 36 Region: 3653-3687
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 37 Region: 2563-2603
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 38 Region: 2488-2525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 39 Region: 2523-2564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000864
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 40 Region: 2121-2169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.024
Further Details:      
 
Domain Number 41 Region: 2617-2652
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 42 Region: 4370-4412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.033
Further Details:      
 
Domain Number 43 Region: 4272-4305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000375
Family EGF-type module 0.038
Further Details:      
 
Domain Number 44 Region: 3700-3732
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000055
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 45 Region: 4199-4235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000676
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000010002
Domain Number - Region: 4236-4272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000194
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 773-818
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1128-1148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0131
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number - Region: 4308-4341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0287
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010002   Gene: ENSGACG00000007503   Transcript: ENSGACT00000010024
Sequence length 4589
Comment pep:novel group:BROADS1:groupXVI:14554631:14687685:-1 gene:ENSGACG00000007503 transcript:ENSGACT00000010024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCDVGEFHCRDRETCIPEAWLCDGEPDCPDDSDETDTTCAQEVVIRCPLNHIQCVGTKKC
IHFNKLCNGARDCEDGYDEGVHCRGELLSTCHELRCRYRCVMTRNGTFCFCADGFEVGED
GTSCRDHDECAMYGACSQTCTNTYGSYGCSCTEGFILQPDRRSCKAKQDLGDSRPMLLIG
GSDRIVITHLNGTGLQPLRSLSVNGTLALDFQHHQESVCWALSTGSAGHLRCAETRNLRG
FTREREIITQQSLQHVENMAIDWLTGNFYFLDRITDKIFVCNHGGDTCVTILQLDLLNPK
GIALDPLMGMLFFTDYGNVAKVERCNMDGTNRTRLVDYNIEQPTAVALDVVKKLVYWADA
YLDYIDVVDYHGKNRHTVVHGSQVTYIYALAVFEDYLYATQSDPSKGSYPVELLRIHRFN
ITAESRTLASLGNTRGLRVYHKLTQPKVRSQACEIDSYGKPGGCSHICLLSGSYKSRTCR
CRTGYSLGSDRQSCKKPKNDLFLFYGKGRPGVIRGLDMNIKSSDEHIVPIEDLVNPRAID
YYAETGHIYFADTTSFLIGRQKIDGNSRETILKDELDNVEGISVDWIGNNLYWTNDGYRK
TISVARLERASQTRKTLLEGNMSHPRAIVVDPLNSWMYWTDWEEDEVNDSIGRIEKAWMD
GSNRRIFVTSNMLWPNGLTLDHSTGTMYWCDAYYDHIEKIQLNGTGRMVVYNGKELNHPF
GISHYRNFIFWTEYMNASVFQLDLTTGDVTLLRSERPPLFGLRVYDALSQQGDNACNVNY
GGCGTLCLAIPGGRVCACADNQLLQKNNVTCAEASSGASEPQRCKSDEFLCHNQRCIRAL
WKCDGDDDCLDGSDEESHGCYNHTCPVDQFKCSNNRCIPKRWLCDGTNDCGNNEDEANAT
CSAQPCQADQFSCQNGRCIPRAWNCDREEDCGDKSDEISCTFPTCEPLVQFSCSNGRCIS
AMWRCDSDDDCGDGSDEVGCSRSCANTQFQCTSGRCIPDHWACDGDNDCGDFSDENVTCR
GGSALLPSVIECSGEEFHCVTDGTCIPERWRCDGDKDCEDGTDEKGCEGTKRMCDPKAKF
TCKDTGKDLSTAWQSALTDLANSSSEQIKSGFLEGAKSSDGLRERMGCMSPDKICNGKVD
CADRSDEGPICDMCLAARGGCSHQCTVAPGKGVVCFCPPGLHLDSSNKTCEAVDYCSSHL
KCSQVCEQYKTTVKCSCYPGWTLDPDGDSCHSTDPFEAFIIFSIRHEIRRIDLHKRDYSL
LVPGLRNTIALDFHFNHSLLYWTDVVEDKIYRGRLAESGGVTGIEVVVQHGLATPEGLAV
DWITGKLYWIDSNLDQIEVAKLNGDMRTTLIAGGMEHPRAIALDPGQGILFWTDWDATYP
RIEAASMSGGGRHIVFKDMEIGAWPNGLTLDHLEKRIVWTDARSDAIYSALYDGSGVIEI
LRGHEYLSHPFAVSLFGGNVYWTDWRTNTLARANKWTGQNVTVIQKTSAQPFDLQIFHPS
RQPQAPNPCGDNDGRGPCSHLCLINYNRTSSCTCPHLMKLSANKQSCFGLKRFLLYVRRS
EIRGVDIDNPYMNVMTALTVPDIDDVTVVDYDAKEERIYWADIKTQTMKRAFINGTQLET
IISADVVNCRGLALDWLSRNLYWLSSENDESQINAARFDGSLKTSIIHGIDKPRCLVVHP
AKGKIYWTDGNTINMANMDGSNSKVLHQNQKDPVGLSIDYTANKLYWISSTNGTINRCNL
DGNGLEVLETLKRELAKGTALAVMGSKLWWADEESAQLGLVTKRDGQNPVILRNKTSGVV
HMKVYDREGQKGRNQCQINNGGCSQLCFPTSENTRSCSCTVGYNLRSDRMSCEGVDSFLM
YSIHEGIRGIALDPNDNTEALMPITGTLFAVGVDFHAGNDTVYWTDMGLNRISRAKRDQT
WREDIITTGISRVEGIAVDWIAGNLYWTDHGFNLIEISRLNGAYRSVVISEGLDQPRAIA
VHPQKGYLFWTEWGQNACIGRSRLDGSDQVTLVNSGIMWPNGISIDYEENTLYWCDARTD
KIERINLETGESREVVLSVANVDLFSVAVFGAYIYWSDRAYSNGSIRRAFKADTSDAVTL
RSGLGVNLKDVTIFNRGREKGTNPCARSNGGCQQLCFHLGSGRRTCSCAHGRLAEDGFAC
ERYEGYLLFSERTILKSIHLSDENDLNSPVQPFENPAFFKNVVALAFDYSQKTSRSNRIF
FSDVHFGNIQMISDDWTGRSVIAENVGSVEGLAYHQAWDTLYWTSSTTSTITRQTVDQEQ
VGALSRQAVVTLSEDDHPHALALDECQSLMFWTNWNEQRPSVMRSTLAGKNMRVIIGSDI
LTPNGLTIDHKAEKLYFSDGSLGKIERCDYDGSSRYVIVKSGPGNFYGLAIYADFIYWSD
WARRSVLRSNKYTGGDTKVLRADIPHQPMGIIAVARDTNNCELSQCRHMNGGCGDLCLLT
PDGRVNCSCRGERVLLEDNRCVSENSSCNIHTEFECGNGECVNYQLTCDGVAHCKDKSDE
KMQYCDNRSCRKGFRPCYNQRCVASSRFCDRIDDCGDNSDEAFCGNVTCASSESSCKDGS
CVPSSAWCNQVIDCADASDEKGCNHSDCSHFYKLGVTEKDFISCNSTSLCVHRTWICDGA
NDCGDYADETGCQVSHGQKCEEGHFACPSGNCISSVWLCDGQKDCEDGADEFQCDSSCLW
NQFACSKNKCIAKQWLCDGENDCEDGLDESAQICGSVTCAPGLFSCPGSYACVPKRWLCD
GERDCPDGSDELSAAGCAPNNSCDDSSFRCRNGACIPRRFACDHDDDCGDGSDESVECAY
PSCGSEEFRCGDGRCLLSSQWECDGYADCPDHSDELPLNLKCLAAGSLCNGSFFMCSNGR
CISEGSLCDGRDDCGDQSDERNCNVNECLNRRVSGCTQDCRDLPVGFKCKCWPGFHLKDD
GKTCVDVNECSTTLPCSQRCINTYGSYKCLCVDGYEALERNPDTCRALSAEEPFLIMADH
REIRKLSVDGSNYTILKQGLNNIIHIDFDYKKEFIYWVDSTRPSGRKINRMRLNGSDLKI
VHRTAVPSALAVDWIGKNLYWCDAERKTLEVSKANGLYPTALITSSLKNPTDLALDPQTG
YVFWVDCCEPPHIGRIGMDGRGQTVIIDTEIYSPTALTIDYTSKRLYWADDNHILLANMD
GTQRRKVSYDHIQGVMALTLFEDFIYWTDGKSKSLRRAHKTTGAQGMELLNSWQAIKSIK
VYHSLRQPEVPKHQCQIANGGCSHLCLLSPGGEHKCACPTNFYLAADNKTCLSNCTSSQF
RCGTDECIPFWWKCDTVDDCGDGSDEPTDCPEFKCQPGRFQCGTGLCALPPFICDGENDC
GDNSDEANCETYICLSGQFKCTRKQKCIPVILRCNGQDDCGDGEDETDCPESTCSPDQFQ
CKASMHCISKLWVCDEDPDCADGSDEANCDEKDEKTCGPHEFRCENNNCIPDHWRCDSQN
DCGDNSDEGNCKPVTCNHKDFACANGDCISSRFRCDGDYDCLDNSDEKGCEERCEEDQFQ
CHNNLCISLKWLCDGQEDCKMGEDEKNCQETAPSCSVNEYVCASGGCVSASLRCDGHDNC
LDGSDETGCVKECREDEFLCLNRAHCIPRRWRCDDVLDCMDHSDEENCSQGAFFCRADEF
ICNNTLCKLHTWVCDGKDDCGDNSDEDLDMCAKLPCPPTRPFRCRNDHVCLRTDQVCNKV
DDCGDNSDEDKCAEVAAGRPRPCGKTEFTCSNQRCIPAQLQCDLFSDCGDGGSDERDCKA
SSSGDVCEKKTNPCGEDAICNQTNANAVCQCKLGFKRNQQTGQCEEINECLQFDACPHYC
TNTKGSFKCTCDRNYKDINGNCIAKDIGPEDRVLYIANDTEIRSFVYPFNQSHGHKLLTH
IEDNARIIGMDVLFHHQNFIWATQFNPGGIFYKENLERSQTKTNVGNMCPDFRRPRDISA
DWITGNVYWTDHSRMHWFSYYTAHWTKLRYSINVGQLKGPNCTRLITDIAGEPYAIAVNP
ARGMMYWSVIGDHSHIEESAMDGSLRRVLLEKNLRRPTGLAIDYFNQRLYWADPELSQIG
SMRLDGSDPLVTISDRQGISQPYRIDIFEDYIYGTGLKHEVFKIHKYGKESVEFLHLGME
KPTNALVSHRYKQPDGSNPCLRMSCDFMCLLNPSGARCTCPEGKVLVNGTCSDAVISGEL
CRPPCENGGRCLANEKGDWRCYCWPDFSGERCEVNHCTDYCLNGGTCGGSPLGKPTCRCP
VGFSGPFCERRICDNYCLNGGTCDITQGNQPVCRCMAEYTGERCLYHICHHYCVNSKACT
LSSSGYVECVCPARFEGNKCEVDKCLRCHGAPCLINDETGDVVCNCTNGRIAPSCQLCDG
YCYNGGTCHLDPDTNLPFCQCSANWAGTQCERPAPKSSRSDNARGGSIAIIVPLVLLVIL
IVMVVAGVFICRRRQRGKRVQRQPMTNGGINVEIGNPSYNMYEVDHDNHADAGSLLRPNF
TLDPHKETSFTLIVGEQCAVLPGDTHSPLYLFPFIIFSFLRLQPINYSNPVYAKIYIDGQ
NCRKPVISIDERRELLPKKLEGTIHETAA
Download sequence
Identical sequences G3NXD3
ENSGACP00000010002 ENSGACP00000010002 69293.ENSGACP00000010002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]