SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010156 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010156
Domain Number 1 Region: 209-428
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.5e-56
Family Reprolysin-like 0.00037
Further Details:      
 
Domain Number 2 Region: 519-574
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000693
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 798-858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 854-918
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 976-1027
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 6 Region: 923-976
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010156   Gene: ENSGACG00000007650   Transcript: ENSGACT00000010178
Sequence length 1079
Comment pep:novel group:BROADS1:groupVIII:8625098:8649744:-1 gene:ENSGACG00000007650 transcript:ENSGACT00000010178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLAAFLSNLGRYEIAIPVRVGPNGEALDTETQPHHRRRSRSTEDGLPDSLFYQLSTSRNN
FLLNLTLQGGLLSRQFRVEYWKKGRLAWSHPYSPHCHYVGHLQDQPHSSKVALSNCNGLQ
GVIVAGGEEYLIEPLVSPDNQTRTEKGEGAEGRPHVVYKRSSLRHQYKGQSCGVIDEKPL
KGASWWQRTLKTPPHHVGRGQLPLKRSVSRERYVETLVVADKMMVGYHGRRDIEQYILAV
MNIVAKLFQDSSLGNAVNIVVTRLILLMEDQPTLEINHHAGKSLDSFCKWQKNIQHRSSY
GNAIPDNGIAHHDTAVLITRYDICIQKNKPCETLGLAPVGGMCEPERSCSINEDIGLGTA
FTIAHEIGHTFGMNHDGMGNACGPRSQETAKLMADHITMKTNPFIWSACSRDYITSFLDS
GMGSCLNNVPPKQEFVYPTTAPGQAYDADEQCRFQYGVRSRQCKYAEVCSELWCMSKSNR
CITSSIPAAEGTICQTNTIEKGWCYKRVCVAYGTRPEGVDGGWGLWSPWEECSRTCGGGV
SSSIRHCDSPRPTIGGKYCLGERKRFRSCNIDECPAGSRDFRIIQCSNFDSVPFRGKFYT
WKPYRGAGGVKPCSLNCLAEGYNFYTERAPAVVDGTPCRDDSLDVCVNGECKHVGCDRVL
GSDVREDRCRVCGGDGSSCVSVEGLFNDSLPEGGYEEVVRIPKGSVFIHLQELNISLNYL
VLKSKGDQYFINGKLTIDTPRRFNVAGTTFHYRRPTDGPETLEALGPTNITLIVMVLVRE
ENPGIHYRFNPPMNREPLTGFAWHYTSWSRCSALCAGGVQTQQVVCRKQADHSVVYNHFC
DKKNKPKEKRRSCNTEPCSSSWWTGEWSDCSRSCNSGLQTREVLCKRRISVTEEKVLDDS
ACTNPRPSLTEPCSNQSCPPEWLALDWSECTPSCGPGYRHRVVLCKRGESGDNLPDSKCS
KHGRPTSRVRCNLQRCPPPQWVTGPWGECSARCGLGQEMRSVQCLTPNGQPSNECLEHQR
PSAMQQCKSKCDLSLPISTDNPEECKDVNTVAYCPLVLRFKFCSRPYFRQMCCKTCQGH
Download sequence
Identical sequences G3NXT6
69293.ENSGACP00000010156 ENSGACP00000010156 ENSGACP00000010156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]