SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010250 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010250
Domain Number 1 Region: 1538-1713
Classification Level Classification E-value
Superfamily Fibronectin type III 7.5e-29
Family Fibronectin type III 0.00015
Further Details:      
 
Domain Number 2 Region: 1913-2082
Classification Level Classification E-value
Superfamily Fibronectin type III 1.9e-25
Family Fibronectin type III 0.00012
Further Details:      
 
Domain Number 3 Region: 1723-1895
Classification Level Classification E-value
Superfamily Fibronectin type III 3.34e-25
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 1261-1437
Classification Level Classification E-value
Superfamily Fibronectin type III 5.03e-25
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 5 Region: 713-887
Classification Level Classification E-value
Superfamily Fibronectin type III 5.47e-22
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 6 Region: 905-1072
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-20
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 7 Region: 346-399
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00041
Further Details:      
 
Domain Number 8 Region: 406-460
Classification Level Classification E-value
Superfamily Kringle-like 1.51e-18
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 9 Region: 1446-1535
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-18
Family Fibronectin type III 0.00012
Further Details:      
 
Domain Number 10 Region: 1091-1254
Classification Level Classification E-value
Superfamily Fibronectin type III 6.12e-16
Family Fibronectin type III 0.000034
Further Details:      
 
Domain Number 11 Region: 2362-2405
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000877
Family Fibronectin type I module 0.0015
Further Details:      
 
Domain Number 12 Region: 555-601
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000111
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 13 Region: 618-694
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000336
Family Fibronectin type III 0.0000272
Further Details:      
 
Domain Number 14 Region: 223-266
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000034
Family Fibronectin type I module 0.00023
Further Details:      
 
Domain Number 15 Region: 513-557
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000733
Family Fibronectin type I module 0.0054
Further Details:      
 
Domain Number 16 Region: 86-130
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000131
Family Fibronectin type I module 0.00046
Further Details:      
 
Domain Number 17 Region: 176-222
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00023
Further Details:      
 
Domain Number 18 Region: 2317-2360
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.005
Further Details:      
 
Domain Number 19 Region: 462-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000301
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 20 Region: 134-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000419
Family Fibronectin type I module 0.0002
Further Details:      
 
Domain Number 21 Region: 2404-2446
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000179
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 22 Region: 43-82
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000393
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 23 Region: 301-338
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000583
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 24 Region: 2228-2291
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000118
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010250   Gene: ENSGACG00000007714   Transcript: ENSGACT00000010272
Sequence length 2501
Comment pep:novel group:BROADS1:groupXVI:14995861:15018552:-1 gene:ENSGACG00000007714 transcript:ENSGACT00000010272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRCTVASVLVALWIGSAVRCVPEAARRSRRQAQQHHVSSVSQDGCLENGQFYGVNDQWE
RPYLGSVLVCTCYGVAGIKCKSKPEAEEKCYDKINQQSYTVGETYERPKDGFIWDCTCIG
SGKGKISCTIGNRCHEGGASYKIGDTWKRPHETGGYMLECVCLGNGKGEWTCKPVAERCY
DNSAGTSYLVGETWEKPYQGWMVVDCTCMGEGSGRITCTSRNRCNDQDTLTSYRIGDAWS
KTDAQGHLLQCLCTGNGRGEWKCERHASLHTTGLGTGSRVITNIQPAVYHPAAVPEPAQE
GPCRTDAGLSYFMGQRWMTKQGTKQMICICLGNGVSCEPWDGPAPVYGGNSGGQPCVFPF
VYKGKTYHSCISEGRSDGHLWCSTSSDFEADQKYSLCTERNAVIVATRGGNSNGALCQFP
YLYNGRNYTDCTADGRRDGMKWCGTTTDYDGEQRFGFCPMADHEEVCTSSEGVMYRMGEQ
WDKRHDILGHMMRCTCVGNGRGEWSCVAYSQLKDQCIVDSLTYEVNQTFTKQHEEGYTMN
CTCFGQGRGRWKCDAIDQCQEPETRAFYKIGESWDKVIQGIMYKCYCYGNGVGELSCEPQ
QSYPGGNRPVQVIITESGNQPNSHPIQWNAPQSAHITQYVLKWRVKNSQSGWREVLIPGH
LNSYTISGLKPGITYEGQLISVLRFGRRELTRFDFTTNYGSQVATTQGETTPPPPTVDIS
ESVTEITSSSFVISWVSASDTVSGFRVEYELSEQGQTTGQPLVLDLPHTATSVNINELLP
GRKYTVNVYEVTNGGENLILTTSQTTAPDAPADHEVEEVGETSMVISWEKPLAPITGYRV
VYTPSLEGESTELTLPDTATSVTLSDLLPGKLYNVSIYAVEDSLESEPIFVQVNTAGAPM
PEEVSSPTDLQFFEVSDKTIVLTWTGPVGAVSGYRVTAAAVDQSGSPPRVMTMPVTTYIE
VQQLEPGTLYRFNVYTLHNGEESLPLTGEQATKPDAPTDIHFTNVTEDSAVMLWFAPRAK
VTGYRLFLHVEGSAAKQLRLPARLSQYTLLNLQPDTEYTATLHAEQDNALSEGESAVFTT
DLPMGHAPDFSTDVTDTSIIISWTPVPHIAYKLTVRPSQGGEAPRDVNSDSGSIYVSGLT
PGVEYTYSVQPVINGQEQGTPITRRVVTPLSPPTDLNLESNPATGELIVQWNGASTPDIS
GYKVTCTPTNGQQGNSVEEFVEADQSSCTLENLSPGVEYNVSVVTVKDDVESTPISTTIT
PEVPKLTDLTFRDVSDTTISLRWSPLNTTAVTGYRITVVAAGESVPIFEDMVSATTGQYT
VQGLEPGIDYDISVITVTENGESEPTTVTQQTSVPAPTDLGFDQVGPDSIHVTWVPPVVP
NPADINTFLIRYHPIDDEDDITETSSGDGSNNVVLRNLLPNTEYLVSVVCVYEERESSPL
VGTQKTALDSPVGLRFSEIFTNSFTIHWLAPQSKITGYRIRYQMVSGGRAKDERLPPSRN
HFTLTALTADTEYLVNIYAVSGPREGLPLSGTQKTISDAPTDLEVLDSSPTSITVRWDAP
PVTVRYYRITHGESGGHSNPKEFTVPGSQSTATITNLKPGTDYTVTVYAVTGRGDSPASS
TPIYVMHKTGVESPSEMEVMNVNDNSVTVRWSPAQGPIKGYRVTGVPRNGMGQSFTEVVA
PADQTEITFSGLMPTVEYVLSVYALGQDGESSPVVVNALTNVDRPKDMTFSDIDSTSLRI
TWDSPEGIVTSYRVLYSSSEEGERELRPAPRGDAESAVIYGLQPGTEYTVKVIAVHDDTA
STPLVGTQATAISPPTNLQFSQVSPTSFTMRWAVPGQENRLSGLTGLTGYRVVVNPKNKS
GPTKEINLAPDATQAHISGLMIATTYEVHVYALKNSLTSRPVQGEITTLENISPPRRVRI
SDVNDSSITLTWRSKTEIISGFLVEATPTTSSSGYIPIQRTTGPSSRSFVVTGLEPGTTY
KINIYTLKGNGRSAPLTLTATTAKPVVIPPTNIRFTSLNPTSISFTWEPSRSPGVTGYYV
THEEAGGLPREVMPRPNAGQSDAIINGLKPGTEYVIKIVALQNSLRSTPLVGKGRTHHQL
LVPELPQLPVPHRPTTDILDVPESFNDQTFDTNHVHLAGTSGQNQPDQQGQHIYTEYQSL
GPNNGLHGPFSGPREGQRPTLQEPLIYIPVAGPDGNRVPLVKVSDGPLPGLAFGFPDNET
EWPQEAQTITTISWSGVPHTSEYEVSCNPITDLEERGFQMRLPGTSNSATLIGLTSGASY
NVVVEAMRGGAKEKVLEEVVTVGNAVPGDTPISTNRDVCFDTFTQTFHEVGSEWERMSET
GFKLWCRCLGLGSGHFRCDSSKWCHDNNNNYRVGEKWDRQAENGHMMSCTCMGNGKGEFK
CEPHESTCYDDGKMYQVGNQWQKEYLGAICTCTCYGGQQGWRCENCRRPGGLTDVDADLL
QPVHSDVFDRYRENALRKLNIQCPIECLRPELLADALNPTE
Download sequence
Identical sequences G3NY30
ENSGACP00000010250 69293.ENSGACP00000010250 ENSGACP00000010250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]