SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010332 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010332
Domain Number 1 Region: 829-908
Classification Level Classification E-value
Superfamily DEATH domain 1.53e-23
Family DEATH domain, DD 0.0000352
Further Details:      
 
Domain Number 2 Region: 134-226
Classification Level Classification E-value
Superfamily Immunoglobulin 5.66e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 225-276
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000235
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 4 Region: 279-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000366
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 28-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000217
Family C1 set domains (antibody constant domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010332   Gene: ENSGACG00000007780   Transcript: ENSGACT00000010354
Sequence length 919
Comment pep:novel group:BROADS1:groupXIII:7631062:7697424:-1 gene:ENSGACG00000007780 transcript:ENSGACT00000010354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAVRDDDDFLSLSELPETFPSDPPEPLPHFLFEPEEGYIVKNKPVNLYCKATPATQIYFK
CNSEWVHQKDHTVEERVDENSGLVVREATIEITRQQVEELFGPEDYRCQCVAWSSAGTTK
SRKAHVRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEIIDPAEDR
NFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEWSTCNS
RCGRGFQKRTRSCTNPAPLNGGLPCDGQAIQKLACTTLCTVDGVWTEWSKWSACGTECTQ
WRRRECNDPAPKNGGKDCDGTVLHSQNCTDGLCMQSSLFQKSTETKEKSDLGVPSAPSTD
DVALYVGIVIAVIMCLVISVIVALFVYRKTHRDFDSDIIDTSALNGGFQSVNIKTARSAD
LLTAPPDLTNAAAMYRGPVYALHDVSDKIPMTNSPLLDPLPNLKIKVYNSSGLVTPQDDL
GGDFTSKLSPKVTQSLLDNSDTMNLRNQSLARTRDPSCTAHGSFNNQGGHLIVPNSGVSL
LVPAGAVPQGRIYEMYVTVHRKDSLRPPVEDIQTVLSPVVSCGPTGALLTRPVILTIHHC
ADNVQEDWLIQLKNQLAMGEWEDVVVVGEENFTTPCYVQMDLEACHILTETLGTYCLVGQ
SICKAAAKRLKLAVFGPVSCTSLDYHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTL
DFKDSTHNLRLSIHDVPHTQWKSKLIAKYQEIPFYQVWSGSQRTLHCTFTLERLSLATTE
ISCKLCVRQVEGEGQIFQLSNTLEEEVQCIDTSLMDPASNITTLVGPNAFRIPLSIRQKL
CGSLDAPQTRGNDWRLLAHKLHLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAV
LEEMGRHDGSLASMTTEHF
Download sequence
Identical sequences G3NYB2
ENSGACP00000010332 69293.ENSGACP00000010332 ENSGACP00000010332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]