SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010435 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010435
Domain Number 1 Region: 17-295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-84
Family Protein kinases, catalytic subunit 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010435   Gene: ENSGACG00000007863   Transcript: ENSGACT00000010457
Sequence length 302
Comment pep:novel group:BROADS1:groupVIII:8897020:8952064:-1 gene:ENSGACG00000007863 transcript:ENSGACT00000010457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTQPQGQQAAVPVFQPQKPLQPDMGHNSLANFQIEKKIGRGQFSEVYRARYLLDNTSVA
LKKVQIFDLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEDNELNIVLELADAGDLSR
MIKHFKKQRRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLG
LGRFFSSKTTAAHSLAVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDK
MNLYSLCKKIEQCDYPPLPSDHYSEELRNLVDMCINPDPEKRPDITYVYDIAKHMQHLTQ
SS
Download sequence
Identical sequences G3NYL4
ENSGACP00000010435 ENSGACP00000010435 69293.ENSGACP00000010435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]