SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010567 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010567
Domain Number 1 Region: 29-284
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-92
Family Protein kinases, catalytic subunit 0.00000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010567   Gene: ENSGACG00000007972   Transcript: ENSGACT00000010589
Sequence length 726
Comment pep:novel group:BROADS1:groupV:9873036:9882672:1 gene:ENSGACG00000007972 transcript:ENSGACT00000010589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGGARRGGEDAAGRHPASCRDVQSAQYVGPYRLEKTLGKGQTGLVKLGVHCITGQKVAI
KIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENNKYLYLVLEHVSGGELFDYL
VKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQV
GDSLLETSCGSPHYACPEVIRGEKYDGRRADVWSCGVILFALLVGALPFDHDNLRQLLEK
VKSGVFHMPHFIPPDCQSLLKGMIEVNPEKRLTLEAIQKHAWYLGGRNEPCPEQPPPRRV
CVRQISSLTELDPDVLDSMHSLGCFRDRGKLTRDLQCEEENQEKMIYYLLLDRKERYPSY
EDEDLPPRNDVADPPRKRVDSPMLTRHGRCRPERKSLEVLSVTEQGSPTPPRRALDTAAH
SQRSRSVSGASTGLSSSPLSSPREPKQGNATTPRPARAHDRPKALPNPKTQTLPAKGPAD
RSLTKSFYPNCAHSVPQVTPQGSPLPTPLGTPVHHPHHAEGGGGVGSLSLTPPSSPGGGS
GMAASSSAHWRTRLNSFKNNLLGSPRFHRRKLQVPTSEDMSSLTPESSPELAKKSWFGNF
IGLEKEEQIFVVIRDKPLSSVKADIVHAFLSIPSLSHSVLSQTSFRAEYKSSGGPSVFQK
PVKFQVDIAFSEGIYSVTFTLISGPSRRFRRVVETIQAQLLSSHDQPMVQALSDEKNGRP
HGTPTR
Download sequence
Identical sequences G3NYZ6
ENSGACP00000010567 69293.ENSGACP00000010567 ENSGACP00000010567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]