SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010670 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010670
Domain Number 1 Region: 492-680
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.71e-61
Family Hemopexin-like domain 0.00000103
Further Details:      
 
Domain Number 2 Region: 91-220,396-451
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.93e-36
Family Matrix metalloproteases, catalytic domain 0.00000932
Further Details:      
 
Domain Number 3 Region: 343-398
Classification Level Classification E-value
Superfamily Kringle-like 1.94e-21
Family Fibronectin type II module 0.00025
Further Details:      
 
Domain Number 4 Region: 280-336
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-21
Family Fibronectin type II module 0.0003
Further Details:      
 
Domain Number 5 Region: 31-109
Classification Level Classification E-value
Superfamily PGBD-like 1.07e-19
Family MMP N-terminal domain 0.00061
Further Details:      
 
Domain Number 6 Region: 224-279
Classification Level Classification E-value
Superfamily Kringle-like 1.46e-19
Family Fibronectin type II module 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010670   Gene: ENSGACG00000008035   Transcript: ENSGACT00000010692
Sequence length 687
Comment pep:novel group:BROADS1:groupXII:10243727:10248615:-1 gene:ENSGACG00000008035 transcript:ENSGACT00000010692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSVWLGLMMTVILIVGISIHDGWSLPLKSVFVTFPGDIIKNMTDTELAEGYLNKFGYMNT
VQRSGFQSVVSTSKALKRMQRQMGLKETGELDKSTLEAMKRPRCGVPDVANYQTFEGDLK
WDHQDVTYRIINYTPDMEPSLIDEAFARAFKVWSDVTPLTFTRLFDGTADIMISFGKQNH
GDPYPFDGKDGLLAHAYPPGEGLQGDAHFDDDEYWTLGAGPAIKTRYGNAEGAMCHFPFT
FEGKSYTTCTTDGRSDNLPWCATTADFSIDKKYGFCPSELLYTVDGNANGAECVFPFVFL
GEKYDSCTTEGRTDGYRWCATTSNFDNDKTYGFCPSRVCTETAVIGGNSEGEPCHFPFVF
LGKQYDSCTSEGRGDGKLWCSTTDSYDDDAKWGFCPDQGYSLFLVAAHEFGHALGLDHSN
IRDALMYPMYSYVKDFSLHKDDIEGIQYLYGGKTGPDPTPPGPKTPTTTPYPDPDEPTTT
TTAPTPVDPTKDACEMTKFDTITVIEGELHFFKDGHYWKMPSESNGESKGPFSISERWPA
LPAVVDSAFEDILARKLYFFSGNRFWVYTGKSVLGPRGIEKLGLPNSIQKVEGALQRGKG
KVLLFSGENYWRLDVKDQKIDKGYPRYTDVVFGGVPNDAHDVFQYKGHIYFCRDRFYWRM
NSRRQVDRVGYVKYDLLKCSDSSRTQY
Download sequence
Identical sequences G3NZ98
ENSGACP00000010670 69293.ENSGACP00000010670 ENSGACP00000010670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]