SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010826 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010826
Domain Number 1 Region: 27-144
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-39
Family Frizzled cysteine-rich domain 0.000000549
Further Details:      
 
Domain Number 2 Region: 187-300
Classification Level Classification E-value
Superfamily TIMP-like 1.04e-24
Family Netrin-like domain (NTR/C345C module) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010826   Gene: ENSGACG00000008168   Transcript: ENSGACT00000010849
Sequence length 315
Comment pep:novel group:BROADS1:groupXVI:16050510:16058935:1 gene:ENSGACG00000008168 transcript:ENSGACT00000010849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPGLCVSLLAASCALWPAAAVRAASCESVRIPLCASMPWNMTKMPNHLHHSTQDNAVL
AIEQYEGLLGTGCSPDLLFFLCAMYAPICTIDFQHEPIKPCKAVCERAKQGCEPVMKRYN
HSWPDSLACSELPLYDRGVCISPEAIVKAEAPDPYPQDPARCNPESSPDFPMDSNNLHCR
GPNADRCKCKTVKMGFKNYQRNNYNYVIRARVREVRNRGLEPTAVVEVKEVLKSSLVNIP
KETQTLYYSSSCLCPPLSPGEEYLIMGYENDEMSRLLLIDGSIAQKWREKMSRKIKRWNQ
TLQGKGRAAQRRSRH
Download sequence
Identical sequences G3NZQ3
ENSGACP00000010826 69293.ENSGACP00000010826 ENSGACP00000010826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]