SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011118 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011118
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.37e-47
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 243-287
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000034
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011118   Gene: ENSGACG00000008406   Transcript: ENSGACT00000011141
Sequence length 289
Comment pep:novel group:BROADS1:groupXII:10503478:10504891:1 gene:ENSGACG00000008406 transcript:ENSGACT00000011141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRKGADVNRMHGTLKPLHCA
CMVADADCVELLLEKGAEVNALDGYNRTALHYAAEKDESCVELLLEYGAHPNALDGNKDT
PLHWAAFKDNPECVRALLESGACPNARDYNSDTPLSWAAMKGNLESVKVLLDYGAQVHVT
NLKGQTPISRLVALLARGLGTEQEEECLDLLCRAAGRFEIRRADGTLPRELSKDPQLLAR
LTNMVAQAPTLRSLARCAVRQSLGVQFLPTAVKELPLPETIKDYLLLRD
Download sequence
Identical sequences G3P0J5
ENSGACP00000011118 ENSGACP00000011118 69293.ENSGACP00000011118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]