SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011332 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000011332
Domain Number - Region: 224-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00552
Family Laminin-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011332   Gene: ENSGACG00000008571   Transcript: ENSGACT00000011355
Sequence length 762
Comment pep:novel group:BROADS1:groupI:7557008:7561871:1 gene:ENSGACG00000008571 transcript:ENSGACT00000011355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLGALSALLCCSLSCSQTLSPAGRNVCPNVRNPLASVCCTGWRQEGKECPIPVCEGEQA
CPKDEICVHPGVCRCPPGYYGALCKTRCPPDFWAPDCRQVCQCHPYGRCHPATGECTCNP
NRWGPLCQHACKCARHGQCHPVHGNCTCDGGWWTATCSKPCQCVSGGSAGPGCEQLTGRC
QCLKGHWGLKCLASCNCYLSQCNQRTGMCECEAGWWGPSCDRRCNCDLTHSSCDPAGGQC
LCHPGFQGVFCNQPCEGGKYGSGCEMSCGFCRDKKFCSDTDGSCEACESGWNGTRCDRPC
PSGSYGDGCQETCPRCRNNEPCDPKTGQCWRCDPGWTGPRCEEACSNRTFGDACSSPCSP
CFHGDCHHVTGRCVCQPGFQGESCNSSCPALRFGLNCSSACGCSEGDICDPVTGSCPNST
SPQAAVLAGILVPLLLLLLAVLCCCLCCGGGPVDGKDRAAVADGGLSVRVKYHVYSVLAN
IGAALPCISNWSSGLPRVTVSHHDPELTFNHSFIEPPSSGWVTEGSSFDSDEEEEEEALY
CVPPREDIPEVAGGEFHEMSSKCNMFLDPSGFSSEDITSPFNIPRTSSIAKSKRPSVSFA
EGTRFGAKERRGSAQEPGALPGRNKPKSPWGVLMLSALQSQASDNEDFSREPGDQELHRT
PSRDTLHVPGTSGRRRTMSNTVAQKCSQTPTSQVGVLDKVTTVYVTVGKAGRPASKTETS
SEGPVQAMLRRLGSLQRQREQDTGKPKAKGAEGITKPPRRKL
Download sequence
Identical sequences G3P159
ENSGACP00000011332 ENSGACP00000011332 69293.ENSGACP00000011332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]