SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011387 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011387
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-36
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 2 Region: 36-131
Classification Level Classification E-value
Superfamily C-type lectin-like 1.18e-34
Family Link domain 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011387   Gene: ENSGACG00000008611   Transcript: ENSGACT00000011410
Sequence length 261
Comment pep:novel group:BROADS1:groupXVI:17265606:17271429:-1 gene:ENSGACG00000008611 transcript:ENSGACT00000011410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVLLWTLGSLLEETRPWGFRNGIFHNSIWLEQAAGVYHRESRKGRYQLTYTEAKAVCKY
EGGKLATYEQLEAARQIGFHVCAAGWFDRGHVGYPIVKAGANCGFGKVGIVDYGRRRNKS
ERWDAYCYNPNSKECGGVLTDQQKVIRSPGFPEEYQDEQICYWHVRVRLGQRVHLRFLEF
DVEEDVGCLADYLEVFDSYDDVSGFAGRFCGDYLPDDIISTGNVMTLKFLSDASVTAGGF
KLQYVAFDASLSSQNHTRSAH
Download sequence
Identical sequences G3P1B4
ENSGACP00000011387 69293.ENSGACP00000011387 ENSGACP00000011387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]