SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011402 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011402
Domain Number 1 Region: 137-361
Classification Level Classification E-value
Superfamily vWA-like 9.89e-70
Family Integrin A (or I) domain 0.000000106
Further Details:      
 
Domain Number 2 Region: 414-472
Classification Level Classification E-value
Superfamily Integrin domains 3.92e-18
Family Integrin domains 0.00064
Further Details:      
 
Domain Number 3 Region: 29-86
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000466
Family Plexin repeat 0.00081
Further Details:      
 
Domain Number 4 Region: 89-160
Classification Level Classification E-value
Superfamily Integrin domains 0.000000136
Family Integrin domains 0.00086
Further Details:      
 
Domain Number 5 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 6 Region: 637-682
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000314
Family Integrin beta tail domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011402
Domain Number - Region: 523-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family Integrin beta EGF-like domains 0.021
Further Details:      
 
Domain Number - Region: 479-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family Integrin beta EGF-like domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011402   Gene: ENSGACG00000008632   Transcript: ENSGACT00000011425
Sequence length 771
Comment pep:novel group:BROADS1:groupXVI:17276233:17296607:-1 gene:ENSGACG00000008632 transcript:ENSGACT00000011425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSPAALAWSAALCCVLLETCVTPAGGLNLCMSGSATSCEECLLIHPRCAWCAQETFGRG
RSLPSRCDFSQNLERRGCDVRLIESPTSSVSVLQDRPLSSKGSGSSQYDVVQIRPQKISV
SLRPGDQTRFGVQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLALEMGKLTSNFR
LGFGSFVDKNMSPFSYTAPKYQENPCNGFGTKLFPNCVPTFGFRHIVSLTDKVDRFNEEV
QKQMVSRNRDAPEGGFDAILQAAVCKEEIGWRKEAYHLLVFATDDVPHLALDGRLGGLVR
PHDGRCHLDDRNEYSASTEMDYPSLALLGEKLAENNIFLIFAVTKRLYVIYKVINARNQG
VTSKMTDLHKQQRIELKVLPLLFWGFDIDMLYRVAPSASPTSSRCVCVKGRGFPGSSCSE
LKYNAKVSFDVRVEARSCPPRGANRSFTIKPVGFKDRLEVAVEYQCDCGCSRTAQSNSSA
CSATGTYNCGTCHCEPGYLGARCECQEGEAASVHFSACREAEGKQMCSGRGECSCNQCLC
YESEFGKIYGSYCECDDFSCARHKGVLCSGHGECHCGQCKCHAGYVGDNCNCSTETAPCV
ADDGQQRVRARRGGGPFSLFPRKCPAIRLGGGGAGSERECIECRLFSSGRLADNQTCQRL
CKDEIITAEALNSEKLEYKVCLNPPSKQTQLSKQEGGVLRILKEPPDTLGYLSQPALSLR
RPRSISTAHSISLPIHLSRLQASNPLYKQHASTHLVETDFDMFGKSFNGGV
Download sequence
Identical sequences G3P1C9
ENSGACP00000011402 ENSGACP00000011402 69293.ENSGACP00000011402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]