SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011411 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011411
Domain Number 1 Region: 20-215
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000111
Family Protein kinases, catalytic subunit 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011411   Gene: ENSGACG00000008639   Transcript: ENSGACT00000011434
Sequence length 320
Comment pep:novel group:BROADS1:groupXV:5903164:5910657:-1 gene:ENSGACG00000008639 transcript:ENSGACT00000011434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKCVEDFRDPRGCRELVSYKLKKEIVLLQRLQHPNVIKLKGHCAEGRGGEDGRVTVILE
QGNPLQMIQLLQSPWEDRFRVCLDLVRLLHFLSDSPLGSVALLDFQPRQFVTVSGQLKLT
DLDDASAAETSCRTHADCTLQFPHRNFTVLCSARGMCEGLNEKRNIYNAYRYFFTYLLPH
QAPPGFTHLVDHIMNSTGELKADINQTLEAFEHILLLYKSGLHLDNLPPSIIGDYAVMRG
MGTSGSAAYRCWPSYSQQGCVLSVHGAREAAFICNSHSQCSSFTLTGRKTWTGRVLASFS
SGFSHLVPDGTSEVYVKKAK
Download sequence
Identical sequences G3P1D8
ENSGACP00000011411 ENSGACP00000011411 69293.ENSGACP00000011411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]