SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011499 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011499
Domain Number 1 Region: 22-108
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-25
Family Kringle modules 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011499   Gene: ENSGACG00000008705   Transcript: ENSGACT00000011522
Sequence length 263
Comment pep:novel group:BROADS1:groupXIII:8794948:8798405:1 gene:ENSGACG00000008705 transcript:ENSGACT00000011522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKGKTFFWLFLCVGSATCGEEERGCTRANGVQYRGEVHSSSSGLTCLNWANTSRDYDDGV
QPDSQTGVGDHNYCRNPDSSEGPWCYIAGPDGTVQRQFCAVDACKERAPEEAESSKPTET
IPPTESLEPAGTEASQGEVAAVQPVMGISQRVRTGPRKKKDLGMLGYVIGILMMAIIVIL
GVGITFGYFYKRAQDLKKQHEQRVYEREMQRITLPLSAFSNPTCELVDENTIVITAEPET
TPVQDDSEGGDPLMGQQAGTPGA
Download sequence
Identical sequences G3P1M6
ENSGACP00000011499 ENSGACP00000011499 69293.ENSGACP00000011499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]