SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011514 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011514
Domain Number 1 Region: 34-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.58e-127
Family Bee venom hyaluronidase 0.00000413
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011514
Domain Number - Region: 414-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00177
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011514   Gene: ENSGACG00000008707   Transcript: ENSGACT00000011537
Sequence length 438
Comment pep:novel group:BROADS1:groupXIX:9783712:9785782:1 gene:ENSGACG00000008707 transcript:ENSGACT00000011537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLLALALWVGIGEELQVLGNQMKPSRAPLIPHRPFVVIWNAPTESCRLRFKVDLDLSVFD
IVANLNETLSGPNVTIFYHGHLGYYPYYSNSGIPINGGLPQNQSISKHLSKARADIDKLI
PHKDFRGLAVIDWENWRPQWVRNWGAKDIYRNKSKEQIRKLHPNWPESKVEKEAKEGFER
AGQTFMNLTLALAEGRRPDGLWGFYLFPDCYNYGYKQHPQRYTGECPNVEHVRNDHLMWL
WKESTALFPSIYLDHELRSSSNTVKFVHYRVKEAMRIASIARTDFTLPVFVYSRPFYAYT
FVVLSESDLVHTIGESAVLGVSGVVLWGSSEYARSQSNCLTVKKYIDGPLGHYVINVTSA
AKLCSKALCKKNGRCVRKSLDSGAYLHLNPRYFHIHRNPAPRGPRFQVSGHLNNHDILDM
KHKFTCQCYQGWTGVYCE
Download sequence
Identical sequences G3P1P1
ENSGACP00000011514 ENSGACP00000011514 69293.ENSGACP00000011514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]