SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011518 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011518
Domain Number 1 Region: 45-367
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-112
Family Bee venom hyaluronidase 0.0000154
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011518
Domain Number - Region: 431-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011518   Gene: ENSGACG00000008727   Transcript: ENSGACT00000011541
Sequence length 480
Comment pep:novel group:BROADS1:groupXIX:9795678:9798432:1 gene:ENSGACG00000008727 transcript:ENSGACT00000011541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVVPEASSSHHVVPIALTCSWLLLLFHAAFCQKPAKLPLIGRKPFIAAWNAPLDMCTIK
YNVTTNAHRLFHIHGSPRANWTGQNVTIFYANRLGYYPHYTPQGAAVHGGLPQNSSLDLH
LFKAYQDINHFIPSEDFRGLAVIDWEFWRPQWFRNWDKKDIYRCKSKELTARAYVNVTAA
QVEELARRRFEKSAKAFMQRTIQLGTRLRPNALWGFYLYPDCHNYKLHEQNYTGFCPPVE
GQRNDELRWLWNSSTALFPSVAFRKTHTNSVGNLRFSQHRIRESLRIASLTSREYELPTY
VYLRLGYRDEAMAFLTMKDLIYTIGESAALGAAGFVIWGDLNLTSSRHNCTKVKGFLSRR
LGQYITNVTRAAEFCSDFLCRGNGRCVRRDPLSRHYLHLSADSYRIRPAGDEDFAVTGWH
SEHEQRLLARRFRCHCYEGHEGERCDSVNEVREDDGPPPTGCSVPVTLLMLLLGLSTASL
Download sequence
Identical sequences G3P1P5
69293.ENSGACP00000011518 ENSGACP00000011518 ENSGACP00000011518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]