SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011580 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011580
Domain Number 1 Region: 322-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-65
Family SPRY domain 0.00000277
Further Details:      
 
Domain Number 2 Region: 127-192
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.12e-18
Family B-box zinc-binding domain 0.0006
Further Details:      
 
Domain Number 3 Region: 1-63
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000283
Family RING finger domain, C3HC4 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011580   Gene: ENSGACG00000008779   Transcript: ENSGACT00000011603
Sequence length 511
Comment pep:novel group:BROADS1:groupXIX:9929496:9931094:-1 gene:ENSGACG00000008779 transcript:ENSGACT00000011603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SICLDVFTHPVTIPCGHNFCKACITDHWNVNAPSNCPNCKKLFYTRPELQVNTFISEMAA
QFRLSAQQKASSSSSEQQAAQPGEVPCDACTGTKVKALKSCLVCLVSYCEAHLEPHLTTS
GLKRHQLMDPVENLEGRMCTKHNKLLKMFCKTDQMCVCMLCTVLDHKNHEYVPLREEYEG
KKAELGKTEAEVQQMIQKRRLKIQEIKHSLEESVERSQAELIDTIKEKQRKTQKQAEGFI
KELEQEISELKKRSTEVEQLSHSEDPLHLLQSFRTLNTAPPTKDWTGVKVSAPSYEGTVV
RAVHQLEKKLSKQMKKLLEVELKRVQQSAVDVTLDPDTAHPKLILSDDGKQVKHGDVRKN
LPDNPERFNQCVLVLGKQSFSSGRFYYEVQVKGKTDWDLGVVRESINRKGDILMSPQNGY
WTICLRNENKYSAFVRPSVDLSLESWPEKVGVFVDYEEGLVSFYDVGAAALIYSFTDCCF
TEKLYPYFSPSLNYKGTNSAPLIISAVNHTE
Download sequence
Identical sequences G3P1V7
ENSGACP00000011580 69293.ENSGACP00000011580 ENSGACP00000011580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]