SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011653 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011653
Domain Number 1 Region: 19-216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.5e-32
Family Pentraxin (pentaxin) 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011653   Gene: ENSGACG00000008828   Transcript: ENSGACT00000011677
Sequence length 220
Comment pep:novel group:BROADS1:groupXX:10257431:10258487:-1 gene:ENSGACG00000008828 transcript:ENSGACT00000011677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFLLLLVMLTACAAIPQDLSGKMFTFPQQSATSLVKLTASELLYRAVTVCHRSFTDLKR
DHALFSLAAPSNANEFLIFWDETKKGLEPHVKNAMTEYRGLDYKLNMWHSICTTWDSESG
LVQMWFDGQPTIRKFITSGSAITGSNIIILGQEQDSYGGGYYLTQSFVGMMSDVHMWDHT
LSPCEIHKYVDGLNFTPGNVLNWGALEFQITGKVIVEDKL
Download sequence
Identical sequences G3P230
ENSGACP00000011653 ENSGACP00000011653 69293.ENSGACP00000011653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]