SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011732 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011732
Domain Number 1 Region: 194-392
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.96e-50
Family Reprolysin-like 0.00029
Further Details:      
 
Domain Number 2 Region: 409-485
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 7.28e-19
Family Blood coagulation inhibitor (disintegrin) 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011732
Domain Number - Region: 634-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00164
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011732   Gene: ENSGACG00000008875   Transcript: ENSGACT00000011756
Sequence length 726
Comment pep:novel group:BROADS1:groupXI:6054503:6066827:-1 gene:ENSGACG00000008875 transcript:ENSGACT00000011756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGDTATEVTHPKRLVQQIESSEEMAHDHLDTRVKNSTRNTLAVHLAQSSFQVEAFGHTFT
LDLELNHHLLSSEYVERHFKQNGRPSQSVGGEHCYYQGRVRGLPESWAALSTCHGLWVLS
GMFSDGFFSYGIEPVHNGSKQADGAHLIRRMPDIRLSPHCPGTRFHFKHKYCPQDDELKR
SKRYVRRPSVQTETKYIELMVVNDNEMFIQLRRSSSQTKNFAKAVVNMADAIYKEQLNTR
IVLVAMETWTSKNMMPLVEDPLITLQNFMKYRKDNIKDQSDLIQLFSGRTFHSSRSGTAY
TGGVCSLTRGGGINEYGNVGAMAITLCQSLGQNIGMRWNNARNSAGDCRCPDAWLGCIME
DTGYYLPRKFSRCSVDEYTQFLLQGGGSCLFNKPNKLLDPPECGNGFVEPGEECDCGSQV
ECARSGGACCKKCTLTHDAMCSNGLCCSSCKYERRGAVCRQAVNDCDIPENCTGDSSQCP
HNVHKLDGYMCDTNQGRCYGGRCRTRDGQCKGLWGYNSADRFCYEKLNAEGTEKGNCGPG
PEGQGWLQCNKPDVLCGFLFCANVTTKPKFGDLQGEVTSFTLYHQNKYLDCRGGHALLED
GSDLGYVEEGTPCGPNMMCLERRCLPVAAFNLSSCSGSNYGRICSDHGTCSNEVKCICDR
DYTGKDCSVFDPIPEPTVPTGPEKKGPSGTNIIIGSIAGAILLAAIVLGGTGWGFKNIRR
GRSGGG
Download sequence
Identical sequences G3P2A9
69293.ENSGACP00000011732 ENSGACP00000011732 ENSGACP00000011732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]