SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011825 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011825
Domain Number 1 Region: 25-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000124
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011825   Gene: ENSGACG00000008945   Transcript: ENSGACT00000011849
Sequence length 224
Comment pep:novel group:BROADS1:groupXVII:8570785:8572274:-1 gene:ENSGACG00000008945 transcript:ENSGACT00000011849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQKWILVILVFCPNTTSGAAAEKMVKEGELVDIKCKPAQSGSLLIWFRVLPKNMEFIGS
FSPSGLPKSPTASLDSSYGFSKISNGILSLKKFKKSTDSGIYSCAFLKGTQLMFGDVTRL
VGEKETTEVAISNAITSVPNQCTTDTPCVCEQNGNDKQGETSPQMYCSPIILGPLAGACG
LLLLLLIITTLYCNRMRTRRCPHHYKRKQQAVPPGKKMMTSRHV
Download sequence
Identical sequences G3P2K2
ENSGACP00000011825 ENSGACP00000011825 69293.ENSGACP00000011825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]