SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012159 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012159
Domain Number 1 Region: 480-540
Classification Level Classification E-value
Superfamily BPTI-like 5.99e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.004
Further Details:      
 
Domain Number 2 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000772
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 253-306
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 310-365
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000562
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Domain Number 5 Region: 191-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000968
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012159   Gene: ENSGACG00000009212   Transcript: ENSGACT00000012183
Sequence length 560
Comment pep:novel group:BROADS1:groupXVIII:8798059:8802048:1 gene:ENSGACG00000009212 transcript:ENSGACT00000012183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVLQVLGLLQLLAVPAFTLGRPTRDHWGQFGAYGPCSRTCGTGVTTRTRTCITSRTDGG
HNCIGSSKSFRTCNTQECPVGSRDFREEQCSQFDRADFQSKSRTWVPFYGASNPCELSCV
PRGENFFYRHRAAVVDGTPCYVGQTDICVEGVCRILTHAEFVGLDGDADAAHSTAVAAVA
PPPKETLTYIYKVGVYGQCSASCNGGTQHRSVECRLEGRADPRAAEESHCVAQRLQRPHS
QQACNMQPCVAEYSVSSFSVCSVTCGEGKQTRAVTCVGSRGERLPNRACVGLAKPPSVQA
CRRPACYTHVTWHVTDYGLCTRSCGGGVRERRVSCLDMDLNSYPEARCGTATKPLAVETC
NAKPCPRAQMVPSVQDPRTRESTMTGFVPHVPEDPPAPRRQTDIAFPPVIGPYCAQSLHG
CCPDGHTSATGPRNEGCTQDDCVRTRYGCCLDGVTAAGGFGRAGCSEYPTAVQHKAPSTL
PSSGNVCSMPRDEGPCDKWKVRFYFDSGAGKCTQFWYGSCHGNANNFVSMEACQRECGNV
MMTESGPAPHKGTPRRKGTK
Download sequence
Identical sequences G3P3I6
ENSGACP00000012159 69293.ENSGACP00000012159 ENSGACP00000012159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]