SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012292 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012292
Domain Number 1 Region: 2987-3245
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-54
Family YWTD domain 0.00000209
Further Details:      
 
Domain Number 2 Region: 1229-1494
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-53
Family YWTD domain 0.00000203
Further Details:      
 
Domain Number 3 Region: 3835-4107
Classification Level Classification E-value
Superfamily YWTD domain 1.16e-45
Family YWTD domain 0.00000716
Further Details:      
 
Domain Number 4 Region: 1850-2106
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-45
Family YWTD domain 0.0000143
Further Details:      
 
Domain Number 5 Region: 1544-1801
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-42
Family YWTD domain 0.0000301
Further Details:      
 
Domain Number 6 Region: 516-777
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-41
Family YWTD domain 0.00000862
Further Details:      
 
Domain Number 7 Region: 183-453
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-40
Family YWTD domain 0.000093
Further Details:      
 
Domain Number 8 Region: 2157-2427
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-35
Family YWTD domain 0.0000258
Further Details:      
 
Domain Number 9 Region: 2893-2979,3238-3299
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-24
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 10 Region: 99-172,456-504
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-18
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 1133-1221,1487-1539
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000942
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 12 Region: 827-868
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 13 Region: 3327-3367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 2645-2682
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 3528-3567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 16 Region: 868-910
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 17 Region: 3612-3656
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 18 Region: 2685-2725
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 19 Region: 3489-3529
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 20 Region: 953-991
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 21 Region: 1041-1086
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.00021
Further Details:      
 
Domain Number 22 Region: 3570-3605
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00046
Further Details:      
 
Domain Number 23 Region: 2515-2556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 24 Region: 6-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3445-3485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 26 Region: 993-1031
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 27 Region: 908-948
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 2862-2903
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 2774-2810
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 30 Region: 2731-2765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 31 Region: 3409-3444
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 32 Region: 2555-2595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 33 Region: 2812-2851
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000995
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 34 Region: 3288-3323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 35 Region: 3698-3738
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 36 Region: 3369-3407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 37 Region: 3657-3691
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 38 Region: 1804-1853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000427
Family EGF-type module 0.016
Further Details:      
 
Domain Number 39 Region: 2480-2517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 40 Region: 1104-1142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000072
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 41 Region: 53-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 42 Region: 3787-3823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000051
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 43 Region: 4330-4371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Integrin beta EGF-like domains 0.083
Further Details:      
 
Domain Number 44 Region: 786-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000798
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000012292
Domain Number - Region: 4161-4197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000149
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 4197-4230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000152
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 2113-2161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000447
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 4233-4268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00089
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 4269-4309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00161
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 2435-2495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 3743-3794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012292   Gene: ENSGACG00000009275   Transcript: ENSGACT00000012316
Sequence length 4508
Comment pep:novel group:BROADS1:groupXII:11375385:11430574:-1 gene:ENSGACG00000009275 transcript:ENSGACT00000012316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KADELPKTCSPKQFVCKDQVTCISKGWRCDGEKDCPDGSDESPDICSNNRVNQCPVNEHG
CLDLDVCIHMSKVCDGVPDCSDGWDEGPHCRAAEGAPSCASHGCEFHCAVTHDGPLCYCS
NGYELAADKKTCKDFNECNVYGTCSQTCTNTDGSNTCSCVEGYLLQPDNRSCKAKNKPVD
RLPMLLIANLHDIRCTSLSGSSSRLPSIATKQTMAMDFIYAEETVCWIDVGDTPAATQLK
CASIPDLKTVTNIRTINVSLSLHHVEQMAIDWLTGNFYFLDDVDDRVFVCNKNGQTCVTL
LDQELYNPKGIALDPAMGKVFFTDYGSTPRVERCDMDGQNRTKLVDSKIVFPHGITLDLV
NRLVYWADAYLDYIEVVDYEGKNRHTIIQGLLIEHLYGLTVFENYLYATNSDEGNLNPKT
SVIRVNRFNSSDFQVVTRVDRGAALHVYHQRRQPQVRSHACAVDQLGKAGSCSDICLLSN
SHKTRTCRCRSGFSLGSDGKSCKKPDHELFLVYGKGRPGIIRGMDMNAKVPDEYMIPIEN
LMNPRALDFHAASEFIYFADATNYIIGRQKIDGTERDTILKEGIHTVEGIAVDWMGGNLY
WTDDGPKKTISVARLEKASQTRKTLIEGKMSHPRAIVVDPQNGWMYWTDWEEDPTESNRG
KIKKAWMDGSHHQVFLTSKTVLWPNGLSLDIPQGILYWVDAYYDRIELVYLNTTERKVVY
EGQELNHAFGLCHYKEFLFWNEYRGGSIYKLDQATKIVTLLRNERPPIFEIRVYDAHQQQ
VGSNVCRVNNGGCSSLCLAIPDGRSCGCANDQILDVDNVTCKANPSYVPPPQCQPGEFAC
KNNRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPADRFKCQNNRCIPLRWLCDGDNDCG
NDEDESNTTCSARTCPPNQYPCASRRCIPISWTCDLDDDCGDRSDEPDSCAYPTCFPLTQ
FTCANGRCININWRCDNDNDCGDNSDEAGCSHSCSNVQFKCNSGRCIPEYWTCDGDNDCG
DYSDETHANCTNQATRPPGGCHVDEFQCRLDGLCIPMRWRCDGDTDCMDLSDENNCEGVT
HMCDPGVKFSCKDSARCISNCEALVCKLSHHMCPTNDSICLPEGKLCDGTDDCPDGSDEK
LCDLCSLDNGGCSHNCSIIPGEGFMCSCPLGLELGADNKTCQIQSFCAKHLKCSQKCEQE
KSSVKCSCYEGWELEPDMESCKSTDPFKPFIIFSNRHEIRRIDLHKGEFSVLVPGLRNTI
ALDFHLAQSTLYWTDVVEDKIYRGKVSDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYW
VESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASLPRIEAASMSG
EGRRTIHRETGSGGWPNGLTVDYMERRIVWIDARSDAIYSAMYDGSGLIEVLRGHEYLSH
PFAVTMYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPQAPNPC
ATSDGKGPCSHLCLINFNQTFSCACPHLMKLQPDKRTCKESRKFLLYARQIEIRGVDIDN
PYYNYIISFTVPDIDNVTVVDFDAVEHRIYWSDVRTQTIKRAFINGTGVETVVAADLPNA
HGLAVDWVSRNLFWTSYDANKKQINVARLDGSFKNAVIQGLDKPHSLVVHPLLGKLYWTD
GDNISMANMDGSNSTVLFTDQKGPVGLSIDYENKQLYWISSGNSTISRCHLDGTNLEILE
GVRGKLIKATALAIMGDKVWWADQGTDQIGTCDKADGGNWKVLRNNTSPMMHMRIYDEDV
QNAGINLCSNNNGDCSQLCLPTSPTTRACMCTAGYSLKTGQQSCEGMGSFLLYSVHEGIR
GIPLDPADKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTN
GIGRVEGITVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPVKGYL
FWTEWGQYPRIERSRLDGSQRMVLVNVSISWPNGISVDYEGGMLYWCDARTDKIERINLE
TGENRELVLANNNMDMFAVSVFEEFIYWSDRTHANGSIKRGNKDNATDAVQLRTGIGVQL
KDIKVFNRARQQGTNVCKDNGGCEQLCLFRGNGQRTCACAHGMLAEDNRGCRDYDGYLLY
SERTILKSIHLSDETNLNAPIKPFEDPDHMKNVIALSYDYHGGGGKGANRIFFSDIHFGN
IQQINDDGTDRKIVVDNVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQSRSVAYNRNT
VVTMSGEDHPRAFVLDECQDIMFWTNWNEQAPSIMRASLNGANVLAIIGSNIKTPNGLAI
DHRAEKLYFSDATLDKIERCEYDGSSRYVLLKNEPVHPFGLAVYGDYIFWTDWVRRAVLR
ADKYTGSDMKVLRADIPQQPMGIVAVANDTNSCEFSPCRSNNGGCQDLCLPTSDGRVNCS
CRGDRQLLEDNTCSSLNVSCGSVDDFECGNGDCINYSLTCDGMAHCKDKSDEKQSYCANR
ICKKGYRRCMNGRCIGHQFWCDGTDDCGDHSDELPCNMTLCKVGEFQCKDGSCISNFSRC
DQVVNCEDASDEINCQPTDCSRFFRLGVKGVSFQSCEKTTLCYRPGWVLCLLSKCFLGLY
NYKRKLKCPVNFFACPSGRCIPMSWTCDKENDCENGADETHCDYFSFADKFCTSTQFECG
NHRCISSHWVCDGSDDCGDGSDEDQKCKSKTCSPEAFQCPGSHMCVPQRWKCDGDKDCPD
GADESVKAGCMYTNNTCDENEFVCQNRQCIPKHFVCDHDIDCSDGSDESPECEYPACGPD
EFRCANGRCLNQKKWECDGELDCQDGSDEAPKNPRCTDSERACNESAFMCRNGKCLNETS
LCDRNDDCGDGSDELNCFINECLNSKLSGCSQLCDDLKIGFKCRCHPGFHLKRDGKTCVD
IDECTTTYPCSQRCINTHGSFHCLCVDGFELSPNDPTVCKSTSEEEPYLIFANRYYLRKL
NLDGSNYTLIKQGLNNAVALDFHYAEQMIYWTDVTTQGSMIRRMLMNGSNIEVLHRTSLS
NPDGLAVDWVGLNLYWCDKGRDTIEVSKLNGAYRTVLVNNGLREPRAVAVDVRYGYLYWS
DWGDNPHIGRIGMDGTNRSVIVEDKITWPNGLTLDFINDRIYWADAREDYIEFASLDGTN
RHTVLSQDIPHIFAMTLFEEHIYWTDWETKSINRAHKSLGTNKTTLISTLHRPMDIHIYH
PYRQPEVLNHPCQTNNGGCSNLCLLSPGGGYKCACPTNFYLANDQRTCMSNCTASQFVCK
NDKCIPFWWKCDTEDDCGDRSDEPAECPEFKCRPGQFQCGTGICTNPAYICDGDNDCQDN
SDEANCDIHVCLPSQFKCSHPSRCIPGIFRCNGQDNCGEGEDEKDCPEVTCAPTQFQCAI
TKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGD
ASDEPKEECAERTCEPYQFRCRNNRCVPGRWQCDYDNDCGDNSDEDKCMPRQCSESEFAC
TNGRCIAGRWKCDGDHDCADGSDENGCDLKCDNDQFQCKNGHCIPIRWRCDADPDCMDSS
DEEHCGSAAGRHCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECRKFQCPPTRAF
RCRNDRVCLQMSKRCDKVNNCGDNSDELNCVTSSETLPAVPTCEKDEFLCANGRCVSSTL
RCNLFNDCEDYGSDEINCKTDTKLNDCRSNRTQCGDGDEAHCVINGTDSFCSCKPGFRKT
GHHTCGDKNECLQFGVCSHVCNNTKGSYKCSCHKYFTRISDTCKADSMNSSRQILYIADD
NEIRSLDPGMRNWRYEQTFQGDASVRIDAMDLHVKTNRIFWTNWHTGRISSYELPGPSTS
SSSSPSERRITNLQIKELKMPRGIAVDWVAGNLYWTDSGRDVIEVAQMSGQHCKTLVSGM
IDEPYAIVVDPQRGTMYWADWGNHPKIETAAMDGTLRQTLVHENIQWPTGLAVDYFNERL
YWADAKLSVIGSVRLDGSDPLISVSGIKNNLLHPYSIDIFEDYIYGVTYVNNVVFRVNKF
GKGPMENLTTGINHATDIVLYHRYKQPEITNPCDRKKCEWLCLLSPSGPVCTCPNSYVAD
NGTCVERPSPTQSPFSPPTGPCDIPCQNGGSCFLNARLVAKCRCQPSYTGERCEINQCRD
YCKNGGTCAASHTGAPTCRCPKGFTGPNCNRPTCQDYCLNEGNCSVNTGNQPTCSCLPEY
KGDTCEYTKCEGFCYNGGTCLQTANGTKICQCLSQYIGNQCELDKCEFCGTGKCLTSSSG
EVSCSCPNGQIQPSCYSCLDYCSNGQCSVATRTLLPQCKCPVGWRGYRCNVAAAPRDSPS
SSGSTASVIIPVLLLLLLALLVVGAILWYKRRMRGAKGFQHHRMTNGAMNVEIGNPAYKI
YEGDPDDDAGELLDSDYALDPDKPTNFTNPVYATLYMGAHNSRNSLASTDEKKELLSQGD
EDMSDPLA
Download sequence
Identical sequences G3P3W9
ENSGACP00000012292 ENSGACP00000012292 69293.ENSGACP00000012292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]