SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012306 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012306
Domain Number 1 Region: 243-454
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.4e-60
Family Reprolysin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 541-598
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000107
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 1322-1381
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000011
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 1130-1188
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 5 Region: 1497-1557
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000288
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 1183-1244
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000575
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 7 Region: 1009-1063
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000589
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1272-1325
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 9 Region: 1058-1119
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 10 Region: 1386-1441
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000732
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 11 Region: 1560-1620
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000106
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 12 Region: 948-1009
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000109
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 13 Region: 1440-1497
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000811
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 14 Region: 833-889
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 15 Region: 1625-1677
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000012306
Domain Number - Region: 896-949
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0116
Family TSP-1 type 1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012306   Gene: ENSGACG00000009317   Transcript: ENSGACT00000012330
Sequence length 1879
Comment pep:novel group:BROADS1:groupXVII:8948722:8981993:-1 gene:ENSGACG00000009317 transcript:ENSGACT00000012330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEIGAYEIVTPVRVNEAGDKFPTSVHFMRKRRSLDESTGNTAEHWASPAVHYRISAFGEH
YHLNLTLDSGFIAPLYTVTVLGAARGDNVEEKEEEEDTELRHCFYKGLVNAQAEHAAVIS
LCSGLLGTFRSPEGEYFVEPLHSFQGEHYEEEHTKPHIVYRKRASTKQTTVENSACDTSG
HKHKYKKLRKRTAVSAGMFNDVESLSAGLATNALLRSESASSRPANDSSGDSGPHRRSKR
FLSYPRFVEVMLVADSKMVEHHGSNLQHYILTLMSIVSSIYKDPSVGNLINIVIVKLVII
NHESDGPDISFNAQITLKNFCIWQQSQNILDDNHQSHHDTAILITREDICRARDKCDTLG
LAELGTVCDPYRSCSISEDNGLSTAFTIAHELGHVFNMPHDDSNKCKEDGVKIQQHVMAP
TLNYNTNPWMWSKCSRKYITEFLDTGYGECLLDEPVSRPHSLSQPLPGQIYDVNKQCELI
FGQGTQVCPYMTQCRRLWCTSPEGAQRGCRTQHMPWADGTDCSPGKHCKHGLCIAKEHDA
TPVEGAWGVWSPFGTCSRTCGGGIKMAVRECNRPVPRNGGMYCVGRRMKFRSCNSEPCSK
QKKDFREEQCAAFDGRHFNINGLPPNVRWVPKYSGILMKDRCKLFCRVAGSTAYYQLRDR
VTDGTPCGPDTNDICVQGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNIVHY
GYNDVVRIPSGATNIDVRQHSYSGKPEDDNYLAISNNREGFLLNGEFVVSMFKREIKVGN
VVIEYSGSDHVIERINCTDRIEEEIIVQVLSVGNLYNPDVRYSFNIPIEDKPQQFFWDVY
GPWQECSRLCQGERKRKILCSRESDRVVVSDQRCHGTARPAVITEPCNTECELRWDVARK
SECTAQCGLGYRTLEIYCAKINRADGKTQKVDDRYCSNQHKPDDKEGCHGDCNTGGWEYS
PWSECSKSCGGGTRRRGAGCRKAAEAGGDESKCSQRDKTTVQPCNEFLCPQWKTGDWSEC
LVTCGKGYKHRQTWCQFGEDRLDDRFCGSSKPESAQTCQQQECASWQVGPWRQCTTSCGP
GYQMRAVKCVVASYGAVTDTECNAATRPTDTQDCELAQCPSERAVPPHQGLKTQWRFGSW
TPCSASCGKGTRMRYVSCRDNQGGVAEESACAHLPKPPAREVCSVVACGQWKVLEWTACS
VTCGQGKTTRQVVCINFSDQEVNTSECDPDDRPPIEQDCAMSQCLSRSSESRPYPSSPNG
STRNNLPRSQSHQWRTGPWGACSSTCAGGFQRRVVVCQDENGYPANSCEDRSRPNEQRSC
ESGPCPQWIYGNWGECTKPCGGGIKTRLVVCQRPNGERFNDLSCEIHDKPPDREQCNTQP
CPSSPNWSTDPWSSCSASCGRGFKSRKVVCASGSGRPVPEENCQHLSPKPRRQKRCKGGR
CPKWKTGNWGECSASCGDGLQRREVLCPAGGRRIPPEAGCPQRSRPASSRSCRVAECPSR
RSQWREGDWRTCSKSCGAGHRRRALQCVDHNQQQVHEMYCVNQIRPPDLESCNTHSCEST
WITGEWTECSASCGQGYRQRPISCSEVPVENDNYEYGHQSLSNCQGTPPEIYMPCNLDPC
PAPQEWKVGIWGPCSVSCGDGVMERTVQCWPADGRPRNRCSRDTMPETREVCRNPNCHFP
SSCQEVQRMNGPLPDNEHFVNIQGKALKVYCAGMQTETPQEYITLTTGDGENFSEIFGFR
LNDPTQCPANDSRREDCDCRRDYTAAGFSTFSKVRLDLSKMNIITTDWRFAVTVEGKSVP
FATAGDCYSAAPCPQGRFRINLSGTGFKVAEDSSWISQGNHAVADIRKSQDGSRVSGMCG
GYCGKCAPSSGSSLPVTVE
Download sequence
Identical sequences G3P3Y3
ENSGACP00000012306 69293.ENSGACP00000012306 ENSGACP00000012306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]