SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012393 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012393
Domain Number 1 Region: 161-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000143
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 2 Region: 205-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000287
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 126-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000935
Family EGF-type module 0.031
Further Details:      
 
Domain Number 4 Region: 83-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000519
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000012393
Domain Number - Region: 58-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00629
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012393   Gene: ENSGACG00000009397   Transcript: ENSGACT00000012417
Sequence length 317
Comment pep:novel group:BROADS1:groupXV:7208168:7213514:-1 gene:ENSGACG00000009397 transcript:ENSGACT00000012417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLTAVVVILVATGIAKGWECSAGCNTINGFCEKPGKCRCKPGWQGFNCEQCVRFPGCLH
GACEKAWQCVCEDGWAGSLCDQDTRRCSSRPCAGNATCIETGEGRYLCICPHGYAGEDCI
RKRELCLTNSSPCQNGGTCAFDDGSAGYSSCLCPPGSSGEFCEISVDSCQPNPCLNGGNC
TGRGLGFTCVCPIGFAGFTCNDTSHSPCAGRPCANGGMCVGQPDGTFRCICQKWFTGPTC
SLQHRPKARPKPAGAKPVDHRVFALTPQHYSLPAHTFHKLLRPPERDLLKITLKETVHSP
GVLDTHGQLICFGMLAL
Download sequence
Identical sequences G3P470
ENSGACP00000012393 ENSGACP00000012393 69293.ENSGACP00000012393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]