SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012565 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012565
Domain Number 1 Region: 101-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000129
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 61-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000383
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000012565
Domain Number - Region: 468-733
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00595
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012565   Gene: ENSGACG00000009517   Transcript: ENSGACT00000012589
Sequence length 738
Comment pep:novel group:BROADS1:groupVIII:12041725:12054205:-1 gene:ENSGACG00000009517 transcript:ENSGACT00000012589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSWCCFLLCLHSLLQVCNLSNNCHQCHPLAACKAQNGSNPACFCNQGYTGDGTTFCEDDN
ECRNVTNICGDRGNCTNTVGSYYCTCVSGYTSTGVAKFQPNDGTECIDIDECKAGQECGP
NAHCHNTNGSFYCTCQRDYIQTSGTKHFHPESGVRCKEHPQKYCHDNIGCITQTVNKTLE
YMSNLTEPQSLLDEIAKQTSGELTSVEVIAYVEALCRSASTLAAEEKDYAVKPSVINSTL
TKLVKAVNNLVEKDELVAWSRMKEDRREHTITKLLHSVEERALTLANNYKTPAEIEIKAS
EMELKVFTFDVRHMKATLSASMGGDHINLTPKLRPQGDRNGSVSVLFVRYDSIADILKPS
GDPGVTDYSRRAEAGEITVNSQVIAAAVKPADVYQLDHVTFVLKHNQPVDAAADGTTCAF
WEYEPGSFRGHWATHGCKTVHVSSNATTCSCDHLTHFAILMSSGRADLAAHNTTLTRITQ
LGMIISLICLSMCIFTFWFFSEIQSTRTTIHKNLCCSLFMAEFIFLVGINMNTHKLFCSV
IAGLLHYFFLAAFSWMCIEGIHLYLIVVGVIYNKGFLHRNFYIFGYGSPAVVVAISATLG
SKYYGTDKVCWLSTENHFIWSFIGPACLIILVNLLAFGVIIYKVYRHTAVKRPEISHYQN
IRSCARGAFALLFVLGATWTLGVLHILNETTLTAYLFTLANAFQGMFIFIFLCVLSRKIQ
EEYYRLFKNVPCCFECLR
Download sequence
Identical sequences G3P4P2
ENSGACP00000012565 ENSGACP00000012565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]