SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012697 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012697
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-53
Family SPRY domain 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012697   Gene: ENSGACG00000009627   Transcript: ENSGACT00000012721
Sequence length 344
Comment pep:novel group:BROADS1:groupXX:11403589:11405982:1 gene:ENSGACG00000009627 transcript:ENSGACT00000012721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFEEFGMYQNHIKETNNNCNEGLVSDHKNSFDSLEREISAEFANLHLFLDEEECKEIERL
RREKQKQLKQLKERKKKMAEQGRDLERAISVLNSKLTEENSPKLIREIQDLLKRQVFSVK
LFFLSTVSPQLSEVDTEVRSGQFVGPIQYRIWKHMRSSLYPNITPMTIDPDTAHPNLSVS
QSCTSVCFEEDKDTKHVQANPRRFHYYYCVLGHQSFTTGRHYWEVDVGQKTAWRLGVARG
DVPRGEMDATGASSGLWTLALMGGSVQAYTDPKPTKVNVSLRLVRIGVLLDCEKEEVSFY
NAVTMAPIYTFTMGTVGVPLFPFYNPCDADDGKNTESLKIFNPS
Download sequence
Identical sequences G3P524
ENSGACP00000012697 ENSGACP00000012697 69293.ENSGACP00000012697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]