SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013098 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013098
Domain Number 1 Region: 623-1198
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.32e-237
Family Neurolysin-like 0.000000000000177
Further Details:      
 
Domain Number 2 Region: 24-600
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.55e-222
Family Neurolysin-like 0.00000000000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013098   Gene: ENSGACG00000009898   Transcript: ENSGACT00000013123
Sequence length 1284
Comment pep:novel group:BROADS1:groupV:11674619:11688534:-1 gene:ENSGACG00000009898 transcript:ENSGACT00000013123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPVPGLSGALTASWTPGEYPNTAADALRFLGDYNATAEEVFFNSMSASWNYNTNITDHN
AKLLVNASLEEQAFGSAWGAKAKVFTGEILDALPDPSDRKLIDKIKILGVANLPPKEREE
YNTILSIMDNIYSTAKVHPAPNISWSLEPDLTEIMASSSSYKRLLYVWEAWHNASGVPLR
EHYPRFVELSNNASEADGFHDTGAYWRSSYESATFEQDIEELYRTIEPLYQNLHAFVRRK
LYEQYGPKYINLKGPIPAHLLGNMWAQTWNNIYGMMIPFPDKPNLDVTDEMVNQGYNATR
MFRVAEEFFTSLNLEEMPQEFWDRSMLVKPEGREVVCHASAWDFYNRRDFRIKQCTTVTM
EQLFTVHHEMGHIQYYLQYKDQPVGYRSGANPGFHEAIGDVLSLSVSTPQHLKNISLLET
VTTDPETDTNYLLKMALEKIAFLPFGYLIDQWRWGVFSGKTPPDRYNADWWYLRTKYQGI
CPPTKRTEEHFDPGAKYHIPGNTPYIRYFVSFILQFQLHEKLCAAAKHTGPLHTCDIYRS
AEAGAILKKILQAGSSKSWPEVLQEAIGTRKLDATSLMKYFDPVIQWLQEQNVNETLGWP
DFNWVPPIPEGYPEDIDKNTDELDAKKFLDEYNSTAEVVWNAYTEASWTYNTDINEANKQ
AMLKKNLEMSAHTLEYGQRARQYDTTDFQDGSVKRVIQKLSDIERAALPTAQLEEYNNLL
SNMETKYSVAEVCRDDGRCHPLDPDLQKIMAESRDYDELLFAWKGWRDSAGKVLRQDYKR
YVELANMAAKLNGHSDNGASWRSLYETPSFEEDLEALWKELEPLYQNVHAYVRRALYKKY
GSQHINLKGAIPAHLLGNMWAQTWSGIMDLVMPYPHATQVDATPAMVSQGWNATRMFQES
DNFFTSLGLLPMPQEFWDKSMLEKPSGGRQVVCHASAWDFYNRKDFRIKQCTVVTMDDLI
TAHHEMGHIQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPKHLQSIGLLDKVESN
HESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPSTEYNKEWWNLRMKYQGLCPPV
TRTEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCDAAKHDGPLHTCDIYKSGEAG
KLLGDVMKLGFSKPWPEAMTMITGQPRMSAQPLMQYFQPLIQWLEEENNKNNDVRGWPDY
DWKPSRSRWKAGEAKSTKVDFLGLSVEGASAIAGQWVLLVLGVVLLVATILLAYKYRRIN
SLNAAGRPRREPQRLGNRVQVMVF
Download sequence
Identical sequences G3P675
ENSGACP00000013098 ENSGACP00000013098 69293.ENSGACP00000013098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]