SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013123 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013123
Domain Number 1 Region: 1787-2034
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.96e-52
Family Ankyrin repeat 0.0000000608
Further Details:      
 
Domain Number 2 Region: 396-528
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000534
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 1129-1274
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000115
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 814-944
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000144
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 560-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000875
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 6 Region: 245-414
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000104
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 710-753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000021
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 8 Region: 585-714
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 1099-1142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000107
Family EGF-type module 0.008
Further Details:      
 
Domain Number 10 Region: 940-982
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000143
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 11 Region: 748-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000146
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 12 Region: 978-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 13 Region: 99-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000662
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 14 Region: 136-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000768
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 15 Region: 213-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family EGF-type module 0.016
Further Details:      
 
Domain Number 16 Region: 1347-1383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000136
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 177-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 18 Region: 1471-1503
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0036
Further Details:      
 
Domain Number 19 Region: 520-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000239
Family EGF-type module 0.011
Further Details:      
 
Domain Number 20 Region: 1266-1306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000493
Family EGF-type module 0.01
Further Details:      
 
Domain Number 21 Region: 1308-1346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000768
Family EGF-type module 0.013
Further Details:      
 
Domain Number 22 Region: 1394-1426
Classification Level Classification E-value
Superfamily Notch domain 0.000000968
Family Notch domain 0.0013
Further Details:      
 
Domain Number 23 Region: 57-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 24 Region: 1017-1060
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.02
Further Details:      
 
Domain Number 25 Region: 787-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000312
Family EGF-type module 0.031
Further Details:      
 
Domain Number 26 Region: 1071-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000429
Family EGF-type module 0.039
Further Details:      
 
Domain Number 27 Region: 1435-1463
Classification Level Classification E-value
Superfamily Notch domain 0.00000772
Family Notch domain 0.0052
Further Details:      
 
Domain Number 28 Region: 24-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000839
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013123   Gene: ENSGACG00000009926   Transcript: ENSGACT00000013148
Sequence length 2466
Comment pep:novel group:BROADS1:groupXI:7691283:7715790:1 gene:ENSGACG00000009926 transcript:ENSGACT00000013148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANIRWIILSFLLFMHICEGFRCGDKYRSCENGGTCLDSPSRCICRLGFIGPLCQHLDP
CHRSPCLNGAACKSQVVNGIPQFTCVCQRGFRGQDCSLIDACATSPCANGARCANWNNHY
NCSCPPGFQGKNCRSDIDECRKPGVCLNAGLCINTHGSFRCQCQPGYSGRTCEVSTLPCA
PSQCLNGGTCRQTSDHSYECACLPGFEGHNCENNVDDCPGHKCMNGGICVDGVNTYNCQC
PPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCAIAV
CFNGATCHDRVASFFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTNPLNGRAICTCPAG
FVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQCQCGRGYAGPRCEIDINECLSMPCQN
DATCLDRIGEFTCICMPGYTGTYCEVDIDDCESNPCVNDGICRDMVNGFTCTCQLGFTST
MCQIDIDECASTPCQNGAKCYDRPNGFECRCAEGYEGTLCESNINNCQPDPCHHGTCIDG
IASYTCNCDAGYTGYRCENQLNECHSNPCQNGGKCVDLVNKYICQCQHGTSGTNCEINFD
DCASNPCDYGICKDGINRYDCVCKPGFTGSKCNVEIDECASSPCRNGGTCVDEENGFHCQ
CPEGFKPPYCYSQVDECGSSPCVHGSCRDDINGYRCDCEPGWVGKNCDLDRNDCLPSPCQ
NAGTCIDQLNGFTCKCRQGFRGNLCQVNINECASSPCLNKGTCVDGVASFTCLCELPYSG
PTCAEVLTPCSPNPCANHALCTHTPDYLGYQCNCQSGWQGQLCNVDVNECISNPCKNLGT
CTNKLGGFVCSCRAGFTGLTCETDVNDCSPNPCLSGGSCRDSVNSFYCSCLAGFTGPRCA
LEINECQSSPCKNGATCTDYVNSYTCTCRPGFTGMHCETNIPDCTESSCFNGGTCTDKIN
GYSCTCRSGFTGSHCQYEVNECDSQPCLNGGICQDALESFRCSCPKGYTGNRCQTPVDWC
RRSSSCQNGGRCRQKDASFICDCNNGWSGRYCDISRVSCETAARQRGLQTDELCHHGGHC
VNTGNAHYCKCPADYTGSYCESQVDHCEDKPCRNGATCRGYVGGYQCDCMPGFTGQNCEI
EINECQSHPCQNGGTCIDLVGHYICSCPPGTLGVLCEINEDDCAPPLRVRSAPPKCLNNG
TCVDRVGGYRCNCPPGFTGERCEGDINECLSNPCSPSNSLDCIQLPNDYQCVCKPGFTGR
KCQSRFSVCESQPCQSGGVCSVSGSSATGYTCTCQLGYAGPNCERSMSCRELPCYNGGSC
ALTLRGARCTCLPGYGGPQCQHRSNEGCSSQPCRNGGLCTEETSFPFFHCQCPSGWTGKR
CEQSSRSIEDHIPSCPLADCHSKANDSVCDKECNTFLCRWDGGDCSLAVNPWARCADCWQ
VFNNSQCDESCNNVDCLYDNFDCKKKEKVCNPIYEAYCIDHYADGKCDQGCNTEECGWDG
LDCAGKVPEDLADGVLVLVVLLPPEELLRTSTAFLQKLSAILHTTLRFRLDHNGEAMIHP
YTRKAARLKRELQPHQEVIGSVVYLEIDNRLCSQGLEGCFPSAFSAADYLGALSAVEMLR
FPYPLKEARVQTGEQIPDIDPIPQWAKLMLVGIASLFLLVILVIGMLIARRKREHSTLWF
PEGFFPKKEPSSNKNRREPVGQDALGMKHMPKTVEESLLGDHSDQWMESDCPEPKRLKVE
EPSLLSDCEDAVDSRQWTQHHLAAADIRVPPTMALTPPQGEFESDCMDVNVRGPDGFTPL
MLASFCGGGLEPEIAEEEESEECSANIISDLIYQGASLAAQTDRTGETALHLAARYARAD
AAKRLLDAGADANAQDNTGRTPLHAAVAADAQGVFQILIRNRATDLDSRMYDGSTALILA
ARLAVEGMVEELITCHADVNAVDELGKSSLHWAAAVNNVEATVALLKNSANKDMQDLKEE
TPLFLAAREGSCEAVKVLLAHFANREITDHMDRLPRDIAQERMHHDIVQLLDEYNTVRSP
QGHGGTGHHLSGVHTLSPLMCPPSAFLPSLKNTPQGKKNRRPGAKGSNLAGQHANSLKES
VKARNKKLTLDMQSALLESSVTLSPVDSLDSPHGGASNAGYITNPTSPVAMQSPGLFHSS
MSVPNTPMVHSSMLEGGGPFAVSLAQLNDLGVGAMSLQGRVSMASDVNHGYVLSSGQMGL
NMGLVSPVSVPFDWHSRMPSSQCGQQVVSLVQSGQAGMHPQSPAMQQQNMLMHQQLYRNA
MLQPTPVTSTPTISPVKLPSIADLLNHSISNQQSMARMGTSTPPTPQTSQPPPSFFQQQQ
QQMPQQPSQPQAPAQPPQSATPAAQPTQVVASQPSGSNAGTEDYPTPPSQHSYSSALDAT
PKHYLHLPSEHPYLTPSPESPEPWSSPSPHCVSDWSDSTPSPAVAGPAQTQITQIPEPNG
KMQVFA
Download sequence
Identical sequences G3P6A0
ENSGACP00000013123 ENSGACP00000013123 69293.ENSGACP00000013123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]