SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013192 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013192
Domain Number 1 Region: 2553-2636,2733-2758,2792-2839
Classification Level Classification E-value
Superfamily Sialidases 0.0000000231
Family Sialidases (neuraminidases) 0.056
Further Details:      
 
Domain Number 2 Region: 577-686,780-864,963-1024
Classification Level Classification E-value
Superfamily Sialidases 0.000000118
Family Sialidases (neuraminidases) 0.027
Further Details:      
 
Domain Number 3 Region: 1549-1639,1698-1743,1880-1950,2050-2106,2266-2355
Classification Level Classification E-value
Superfamily Sialidases 0.00000504
Family Sialidases (neuraminidases) 0.027
Further Details:      
 
Domain Number 4 Region: 1161-1193,1312-1397
Classification Level Classification E-value
Superfamily Sialidases 0.0000188
Family Sialidases (neuraminidases) 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013192
Domain Number - Region: 2504-2529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family Integrin beta EGF-like domains 0.028
Further Details:      
 
Domain Number - Region: 691-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 1049-1075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 1789-1813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 1354-1364,1416-1459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0832
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 3252-3277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0903
Family Integrin beta EGF-like domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013192   Gene: ENSGACG00000009959   Transcript: ENSGACT00000013217
Sequence length 3478
Comment pep:novel group:BROADS1:groupXIX:11394729:11472962:1 gene:ENSGACG00000009959 transcript:ENSGACT00000013217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMAAAWASLGGALGCALLALVLGSSMDFGAPPASFYPRFNPFFFLCTHHGELDGIGVAEG
GGEVLLTLQITGNPIAYTPGQEYQVTISTSVSFDGLLVTGLYTSTPFQSAPIPAPAAFGF
GVMPERQFGGTQFVCSVVASHVSHQPSSSFSFVWIAPPPGTGCVNFLATATYRGQIIFKD
ALAQQLCEQGAPTESPLRPSLVELHGKHAVLRDDFDSNLQGELDPSIWSECRNCEVGEQC
GVLMHGRAVTFCEPFGERELTTVPLNTSTASVLQFALGSGSCRFSYSDPSITVSYSLSGN
ANTSDDWITLEKIRAPTNSSTVVHLLPLPHQSRADGVRLRWSQEVPRGPEGYESCWGLDN
VLLVNAAHRAPLMEDNLDPPDTANWLFFPGATVKHACQSEGNALYFHGGEGVGHSFASTR
DIDLHREEGRSYWEEDFESLPSNWDIEGAVCGTHCGEIESGSALVFEKEGRRRLCTPYLD
TTSYGNLRFYFTMGGGDCDPGESHENDVVLFGRSEGRRERVALDSLPYSSYRSPALVSVA
LPTELQTPVTQFCLEQRSHGGANRHVWAVDFMQLLPVLPGTHTHVAQFSINLGCGSYQPA
NSVSLEFSTNHGRSWSLLHTECLPELCAGPHLPHSTIYSSDNYSGWTRISIPLPNAALTE
TTRFRWKQTSTGLGNMWAIDNVYLGPACLRFCSGRGHCSRTGCKCDPGFSGPACELASQT
FPAFLSEGFSSPRLSSYHSFSSLRGAEVSFGCGVLASGKALVFNRDSRRHLVTSPLDSSQ
ARYLQFTLRLGSRSTLSSCPAPDQPGEGVLLHYSSDNGITWTLLQHYAYQGFHEPRIVSV
ELPAGARKFGVQFRWWQPYHSGRGHDVWALDEISMTSVLFNTISLDFSNVLDVTQSLGFY
LGLVQPYCQHDWTLSFSGEPSPGSSIRYVETQSMQIGASYSLQFSLVMGCGREPSPHIDT
QVRLEFSTNHGLTWHLVKEACLPGMTSCSEFTAPSVYHPSEFKDWRRITLSLPQKTWSSA
TRFRWIQNYYGEQDEWALDDIYIGQQCPNMCHGHGWCDHGHCRCDEGFSGTDCQPSSPLS
SSVLSDFESQDALLATWREVIGGEVVTPDMGCGVVSSGSSLYFSKAGLRQLLSWDLDTEW
AEFVQFYLRVGGDWAECNQADSREEGVLLQYSNDGGINWGLIAEMYFTDFTKPRFVHYEL
PLASKTPSTRFRWWQPLHSGDGYDQWAIDDIIILSEREKHIIPMANPTLPQNFYEKPAFD
YPLNQMSVWLMLGNEGMERESNNSFCASTPSAMVFGRSDGDRVAVTRDLALRSGYTLQFK
LNIGCESEFSASAPVMLQYSHDAGRTWALVREGCYPGTLGAGVCEGSGRELREPTVYNTG
DYEQWTRVTVVIPRNVAASKTRFRWFQESSVYRDAPPFALDGVYISEPCPNHCGGHGDCI
SGVCFCDMGYTVEQDSCVPSVAGPTELTEGFEGKLSPLWQSLSGGQIGGGCGIIGEGKAL
YFSSPGRREARTVPLDTTNTRLVQFYIRIGSKSLGPTCTRPRSRNEGVIVQFSTNNGVQW
QFVRELDFSSFLEPQVVTIELPPVAKTPYTVFRWWQPQQGKHSAQWALDDVLIGMNDSSR
TGFHDKFDGMTPLRHNWYRVQGGEVTVDCLSLDTALTFNSEAIDKKPRYAESWDFEVSGS
SFLQFELSMGCSKSTSFSHGVRLEYSTDCGHHWSLITPECVPPAIGCAGYTQSSIYTSTQ
YKHWRRITVYLPSAANSPRTRFRWIQTHFTPGAEGWALDNVLLAPGCPWMCSGHGLCDNG
RCVCDKAYGGTHCVPLAQLPTVLREDFNENLQQETWPEVYGAERGTLSGEPLKSGTALIF
KGDGLRMIVSRDLDCTNTLYIQFSFKFITKGVPERSHSVLLQYSVNGGISWLMLDEFYFP
ASTDTLFLHLPLPASAQTNATRFRLWQPYNSGKKEEVWVIDDLIIDGSSLHNPPTVIDSF
DEGPNESNWLFFPGGNTGLYCPYQKTGIEEDDSAMVFVSSELGEHSITTRDIDVNENTIL
QFEINVGCTSESSSSHPVRLQFSRDFGATWHLLVPLCAGGPQPSSLCSTELNPASVYFPG
TTQGWRREVIHSGKLRLCGSVRFRWYQGFFSTGSSPPTWALDNIYIGPQCQDMCNGHGTC
VGGSHCVCDPGHSGSDCSVPDTPNPDFLKEDFEGGAVDAERFRLLSGGKPSRKCGIMSSG
NHLFFSEDGLRMLVTNDMDLANARFVQFFLRLGCGKAAPDPRSQPVLLQFSVDGGLSWGL
LQEFLFSNSSNQARLVALEIPLRARTSSTRLRWWQPSENGHFYSPWVIDQVVVGGSASGW
GPLEDDFSSTDGRSWLLHPGGTRMPVCGSDGPAFAFIEKSNTRYAVTTDISLGPDAFIQF
DFSASCSVTNSCYSVELEYSLDLGLTWQPVVRDCLPTSPDCSSFTLQRLLVSDTFNKWGR
ITLPLPSYARSPATRFRWFQQAPFDKQQTWALDNLYIGDGCPDMCSGHGRCQQSSCVCDP
EWGGEYCDEPVVPLPSQLKDSFSRAPSLSHWHVLTGGKLSTVCGAVASGAALHFSGSCSR
QLVTVDLNLTHAEFIQFYFMYGCMIPPSNRNQGVLLEYSLNGGINWHLLTEIFYDLYTKP
GFVNVLLPPAARQEGVRVRWWQPQHEGADSGDWALDNILIAGSDPRAQISDTFGGVALPN
HERTPADGTSGRIGQLSEQEETPIVSDHWLFSEDCSVQRFCSSPDGVMVCGNADGSEVYA
VTHDIIPDKGWVMQFKIAVGCVEPERHAERQIHVQYSVDFGVTWKYLTPQCLPADPRCGG
QVSQPSVFFPAEGWKRAVYPLADSLADTAVRFRFFQQHSDIQWGVENFYIGPACDGHCGG
HGDCLDQRCLCDPGFTGPNCYASTPLKASLKERFDWEGAAGPQWQVLEGGRPCTDCGVLV
EGTALYFGGADARQAVTADLDLRGAKFVEYWARIGSDDNMTMCHRPTCRKEGVLLDFSTD
GGVSWTLLHEMDYLKYVSVRRDYIVLPEGALTNATRLRWWQPFTISSGLATPSLERAQWA
IDNILVGGSDINPPTLLDTFDDEGVSHEESWSFYPNAVRTAGFCGNPSFHLYWPNKNQDK
THNILATRELIVQPGYILQFKIVVGCEADTCGDHHSVLLQYRKNARSDSWQLVQSECLPS
SVNKVGCSPFQFHESTIYSPVNSSTWTRVTVQLPDHVSSGATEFRWIQKEGTGERQSWGV
DHVYIGEACPGLCSGHGYCTSGAVCICDEGHHGDDCSLFGSDLPSSIKDNFESGSMSPES
WQLIQGGGVGSGCGQLSPHAHGDSLYFNGCKMRQAVTKPLDLTRASKIMFVLQIGSLAQT
DSCNIALDQPDTVDRAVLLQYSVNNGVSWHVIAQHQPKDFIKAQRVSYNIPLEARVKGVM
LRWWQPRHDGAGHDQWALDHVEVVLIHTRKQNYMMNFARQTGTRHYYSRKRRALQQRA
Download sequence
Identical sequences G3P6G9
69293.ENSGACP00000013192 ENSGACP00000013192 ENSGACP00000013192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]