SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013336 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013336
Domain Number 1 Region: 20-68
Classification Level Classification E-value
Superfamily GLA-domain 8.75e-20
Family GLA-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013336   Gene: ENSGACG00000010095   Transcript: ENSGACT00000013361
Sequence length 215
Comment pep:novel group:BROADS1:groupVIII:12833534:12837661:-1 gene:ENSGACG00000010095 transcript:ENSGACT00000013361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVFLPADAAHSVLRRLRRANFLLEEIKQGSIQRECREEVCTYEEAREAFENDEKTRRF
WEEYVRESSPSGGLETVVGGVHSLYLIVPLLLVVLVIVAVAITVWRCHSRKRSQRSPSLG
HSHHDHVLSVVSMDHWGRDYHHGDQSELSVHSSPAYPGSELTSGRGSAGDPPPSYEEAVG
HSDVQIETEPPPQYEDIVNTNASSVNGGHGNTSRS
Download sequence
Identical sequences G3P6W2
69293.ENSGACP00000013336 ENSGACP00000013336 ENSGACP00000013336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]