SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013495 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013495
Domain Number 1 Region: 251-410
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.28e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000216
Further Details:      
 
Domain Number 2 Region: 81-242
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000027
Further Details:      
 
Domain Number 3 Region: 44-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000629
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 2-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000347
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013495   Gene: ENSGACG00000010214   Transcript: ENSGACT00000013520
Sequence length 411
Comment pep:novel group:BROADS1:groupXIII:10095652:10137363:-1 gene:ENSGACG00000010214 transcript:ENSGACT00000013520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPCHPNPCHNRGTCEISETYRGDTFIGYVCQCPPGFSGVHCQHNINECERDPCKNGGICT
DLVANYSCECPGEYMGRNCQYRCSGPLGMEGGIISNQQITASSTHRALFGLQKWYPYFSR
LNKKGLVNAWTAAENDRWPWIQINLQRRMRVTGLITQGAKRIGSPEYVKSYKVAYSDDGK
TWRTYKVKGKDDDMIFRGNVDNNAPSANSFTPPIKAQYVRIYPQVCRRHCTLRMELLGCE
LTGNLIVFLPGCSEPLGMKSGHIQDYQVTASSIFRTLNMDMFTWEPGKARLDKQGKVNAW
TAGHSDQSQWLQVDLLVPAKVTGIITQGAKDFGHVQFVGSYKLAYSNDGERWKIYQDEKQ
GKDKVFQGNFDNDTHRKNVIDPPVYARLIRILPWSWYGRITLRAEVLGCTE
Download sequence
Identical sequences G3P7C1
ENSGACP00000013495 ENSGACP00000013495 69293.ENSGACP00000013495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]