SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013669 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013669
Domain Number 1 Region: 2304-2377
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.35e-19
Family TB module/8-cys domain 0.00048
Further Details:      
 
Domain Number 2 Region: 919-988
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.45e-19
Family TB module/8-cys domain 0.00064
Further Details:      
 
Domain Number 3 Region: 2096-2224
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.3e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 2419-2545
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-18
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 5 Region: 287-353
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-17
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 6 Region: 680-822
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 1815-1945
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.27e-16
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 8 Region: 1162-1302
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 2019-2088
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-16
Family TB module/8-cys domain 0.0001
Further Details:      
 
Domain Number 10 Region: 1654-1720
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-16
Family TB module/8-cys domain 0.00053
Further Details:      
 
Domain Number 11 Region: 813-897
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.37e-16
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 12 Region: 141-226
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000126
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 13 Region: 994-1124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000196
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 14 Region: 417-545
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000228
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 15 Region: 618-690
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000301
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 16 Region: 1494-1567
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000916
Family TB module/8-cys domain 0.0000507
Further Details:      
 
Domain Number 17 Region: 1370-1504
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000345
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 18 Region: 182-298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.0071
Further Details:      
 
Domain Number 19 Region: 544-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000443
Family EGF-type module 0.014
Further Details:      
 
Domain Number 20 Region: 2544-2660
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000132
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 21 Region: 1122-1177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000617
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 22 Region: 2379-2428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000726
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 23 Region: 1979-2031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000884
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 24 Region: 1573-1628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.00053
Further Details:      
 
Domain Number 25 Region: 1941-1993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000545
Family EGF-type module 0.007
Further Details:      
 
Domain Number 26 Region: 1732-1787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 27 Region: 1335-1373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.021
Further Details:      
 
Domain Number 28 Region: 1294-1332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000183
Family EGF-type module 0.021
Further Details:      
 
Domain Number 29 Region: 2257-2306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000184
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 30 Region: 1775-1813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000173
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 31 Region: 2218-2264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000055
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013669
Domain Number - Region: 112-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00495
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013669   Gene: ENSGACG00000010321   Transcript: ENSGACT00000013694
Sequence length 2833
Comment pep:novel group:BROADS1:groupVIII:13022532:13062921:-1 gene:ENSGACG00000010321 transcript:ENSGACT00000013694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQVSFVYSKGLGQILGRPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPN
MCTCSSGQLSPSCGSGGVQSCNVRCMNGGSCAEDSCSCTKGFTGNHCGQPVCENGCQNGG
RCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLSGIVCTKTLCCATIGRAWG
HPCEQCPAQPHPCRRGFIPNIRTGACQDVDECQAVPGLCAGGNCINTVGSYECKCPAGHR
QSETSHKCEDIDECSTISGVCDGGECTNTAGSYVCTCPRGYISSTDGSRCVDQRVGTCFS
ALANGRCAAELNGQYTKMQCCCDTGRCWALGQIPEMCPVRGSDEFRRLCIVGVAQGHGLP
HVYPNGHFPNTNGNGYNYGYKFPSVPNGNGNGGNGGNGGVGFGGNGGSFGGTVSVNDTID
VCKHFTNLCLNGRCIPTPTSYRCECNMGYKQDVRGECIDTDECVSNPCINGDCANTPGGY
HCKCHEGFSGTPTKQACNDIDECIVNGVMCRNGRCVNTEGSFQCICNAGFELTPDGKNCI
DHDECATTNMCHNGMCINEDGSFKCICKPGFALAPNGRYCTDIDECLTPGICMNGRCINS
EGSFRCECPPGLAIGVDGRVCVDTHMRTTCYGAIKMGTCSRPFPGAVTKSECCCANAEHG
FGEPCQPCPSRNSAEFQAVCSSGIGITADGRDINECALDPDICQNGICENLRGSYRCICN
IGYESDTSGKNCVDINECLVNRLLCDNGLCRNTPGSYTCSCPKGYVFKPDSETCEDINEC
DSSPCINGACRNVAGSFNCECTHGSKLDSTNTICVDSMKSTCWLTIQDNRCEVNINGATL
KSECCSTLGAAWGSPCEPCEIDTACSRGFARMKGLVCEDINECEVFPGVCTNGRCVNTQG
SFLCECAEGLTLDSTGRTCVDTRSEQCYLKWHEDECGEPLPGRYRVDMCCCSVGSAWGVD
CEECPKPATAEYKAICPRGPGFANRGEILTGRPFYKDVNECKVFQGLCTHGNCRNTIGSF
KCRCNNGFALTAEERNCTDIDECRISPDLCGHGACVNTPGSFECECFEGYESGFMMMKNC
MDIDECERNPLLCRGGTCLNTEGSYECECPPGHSLSNDGSACEDVNECQLSDNLCKHGQC
INMPGTYQCSCDTGYQATPDRQGCVDIDECTIMNGGCETHCTNSEGSYECSCSEGYALMP
DLRTCADIDECEETPDICDGGQCTNIPGEYRCLCYDGFMASMDMRTCIDVNECDLNPNIC
LHGDCENTKGSFICHCQLGYIVKKGSTGCTDVDECEIEAHNCDMHSACINVPGSFKCRCR
DGWVGDGIKCVDQDECSLEDHNCNPNADCVNTPGSYRCTCKSGFNGDGFSCSDMDECADN
VNLCENGQCLNAPGGYRCECEMGFTPTEDSKACQDIDECNFQNICVFGTCQNLPGMFRCV
CDDGYELDRSGGNCTADINECADPVNCINGLCVNTPGSYLCNCPADFELNPTGVGCVDTR
VGNCYLEVLWRGDGGISCSAEIGVGVIRASCCCSEGGAWGNPCELCPSPNSTEYKTLCPG
GEGFRPNPITVILEDIDECQELPGLCQGGNCINTFGSFQCECPAGYYLNEETRICEDIDE
CTTHIGICGPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFN
MTKKMCCCAYNVGKAWNKPCEACPTPATNEYQLLCGNMAPGFIIDIHTGKPIDIDECREI
PGICASGVCINQIGSFRCECPMGFSYNNILLICEDIDECNSGDNLCQRNANCINIPGSYR
CECSPGFKLSPSGACLDRNECQEIPNVCSHGECIDTQGSYRCLCHNGFKATADQTMCMDI
DECDRQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMDVDECSALQGQVCRNGQCINGLG
SFQCLCHEGYENTPDGKNCVDINECVSLPGTCSPGTCQNLDGSFRCICPPGYEVQNDQCI
DINECEVEPNICQFGTCTNTPGSFQCTCQTGFVLSENKRRCYDTRESFCFTKFEAGKCSV
PKYLNNTKAKCCCSKMPGEGWGLPCELCPRESEAAFRTLCPFGHGALPGPGDAREDMNEC
LDNPGICQNGICINTDGSFRCECPFGYNLDYTGVNCVDADECSIGNPCGNGTCTNVVGGF
ECSCQEGFEPGSMMTCEDINECSQNPLLCAFRCVNTFGSYECMCPGGYVLRDDQRMCRAD
QDECSEGLDDCDSRGMTCKNLIGTFMCICPPGMQHRPDGEGCMDLNECRAKPGICKDGRC
VNKVGSYRCECNDGFESSSTGTECIDNRRGYCYTEVLQTMCQQSSTNRNSVTKSECCCNT
GRGWGTQCELCPLPGTVQYKRMCPLGPGYTTDGRDINECQVMPDLCRNGQCINTIGSFRC
HCNVGYKTDFTGTSCVDMDECALSPKPCNFLCKNTEGSYLCSCPRGYSLQPDGKTCKDLD
ECSTKTHNCQFLCVNTIGGFTCKCPPGFTQHQTACIDNNECSAQNSGCGSRASCVNTPGS
FNCECSKGFSLDNTGMECEDVDECGSNHRCQHGCQNMMGGFRCGCPQGYVQHYQWNQCVD
ENECQASTVCGSASCYNTLGSFKCVCPSGFDFAQGAGGCQDVNECSRSNNPCIYGCSNTD
GGYQCGCPGGFYRAGQGHCMTGSGFPGQFEEGDEDDSLSPEACYECKINGGGKNGRHKRN
ADENDLNQEPAVSMASIDTQASIPMNLSLASLHNKEPLLELLPALQPLEHHVRYVITHGN
AKEHFRLLERRDGKSVLRLGKRFPPAGSYRLEIASLRLYGPRRLHQLEEQHDSDYLQGEM
GDALRIKLLIHLH
Download sequence
Identical sequences G3P7U5
ENSGACP00000013669 ENSGACP00000013669 69293.ENSGACP00000013669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]