SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013702 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013702
Domain Number 1 Region: 250-453
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-37
Family Protein kinases, catalytic subunit 0.00094
Further Details:      
 
Domain Number 2 Region: 2-150
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.63e-35
Family L-arabinose binding protein-like 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013702   Gene: ENSGACG00000010362   Transcript: ENSGACT00000013727
Sequence length 549
Comment pep:novel group:BROADS1:groupX:15475061:15487759:-1 gene:ENSGACG00000010362 transcript:ENSGACT00000013727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPQNLEYRQFVETLKNDAKKFNYTINDSLYNLIAAGFHDGVMMYSQALNETLNEQRTGSE
PGAVRRPRGSVVTKRMWNRTFSGVMGPVEMDEFGDRQMDFAVWDTIDVESGEFQVVCVYN
SSMKQLIMQGGRSFQWPGGSPPPDVPKCGFKNDKPACLARTVTMHQMVSIVICFVFVIIV
TVTVFIYRKLKLESELAAQLWRVSWDDVQMSNLDLVLRRTCSRLTLSLKGSNCGSLMTME
GNFQIYTKTGYYKGNLAAIKYMNKKRIELTRKVLFELKHMRDVQNEHLTRFIGACIDPPN
MCIITEYCPRGSLQILMESDSITLDWMFRSLINDIVKGMLFLHNSVMVSHGNLKSSNCVV
DGRFVVKITDYGLESLRPSSFPEDTYAYYARKLWTAPELMRTDTAPPCGTQRGDVYSFSI
ILHEVALLRGVFYLDSLTMTPKEIRRQESTPSRRKNTLNPSEENNYSRSSSSSLFVQNPE
HVSVLSTCPICLPCLFRGYGSNILDNPSVSYEQYANNLEELVEERTQAYHEEKRKAEALL
YQILPHTTT
Download sequence
Identical sequences G3P7X8
ENSGACP00000013702 69293.ENSGACP00000013702 ENSGACP00000013702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]