SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013780 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013780
Domain Number 1 Region: 3341-3493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.25e-30
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 2 Region: 3505-3689
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.21e-28
Family Laminin G-like module 0.00085
Further Details:      
 
Domain Number 3 Region: 3117-3292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-20
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 4 Region: 2727-2918
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-17
Family Laminin G-like module 0.036
Further Details:      
 
Domain Number 5 Region: 2940-3119
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000257
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 6 Region: 1524-1574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000276
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1964-2019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family Laminin-type module 0.002
Further Details:      
 
Domain Number 8 Region: 1916-1966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.067
Further Details:      
 
Domain Number 9 Region: 1572-1620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 10 Region: 1434-1482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000246
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 294-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 12 Region: 353-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 13 Region: 1857-1905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000372
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 14 Region: 670-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 15 Region: 625-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000809
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 16 Region: 534-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 17 Region: 580-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000268
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 18 Region: 767-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 19 Region: 2018-2067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 20 Region: 2065-2115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 21 Region: 487-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 22 Region: 820-860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000131
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 23 Region: 423-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 24 Region: 1818-1859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family Laminin-type module 0.06
Further Details:      
 
Domain Number 25 Region: 717-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013780
Domain Number - Region: 99-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00128
Family APC10-like 0.038
Further Details:      
 
Domain Number - Region: 2523-2669
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00952
Family IMD domain 0.041
Further Details:      
 
Domain Number - Region: 1485-1521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 2192-2293
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0523
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013780   Gene: ENSGACG00000010405   Transcript: ENSGACT00000013805
Sequence length 3690
Comment pep:novel group:BROADS1:groupXII:13049591:13115043:-1 gene:ENSGACG00000010405 transcript:ENSGACT00000013805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGPGPSEQVEMTALALLLWPLVATCCRFASAQELATNGVNGYSLHPPYFNLAEGTKITAS
ATCGEDDGGRALQDLYCKLVGGPVSGDPSQTIQGQYCDICSQGDSDRAHPITNAVDGTER
WWQSPPLSRSTEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSVDFGQTYQPWQ
YFASSKRDCIERFGQSTIERISNDNDIVCTTEYSRIVPLENGEVVVSLVNGRPGALNFSY
SPVLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRCVCNGHA
EACDADEPNNPYRLQCDCRHNTCGLSCDQCCPGYNQLPWKPATTYSANECEPCNCHRHSF
DCYYDPEVDQRRGSIDIHGHNRGGGVCLNCQHHTTGANCERCIPTYYRSPDHSIDSPLAC
SRCDCQSEFSDGTCEDLTGRCFCKPNYTGENCDSCASGFTNFPDCYSIPTSNNNGEAKPA
GEIIPDCECSAAGTVDNFCRPDPRTRTCICKPGFTGGHCDTCAPGFYGSNCQACQCSGPG
CLDGSCDLVTGHSVCRSGFRGYQCDQCAPGYFNYPLCQLCGCSTVGSLPEGCDASGRCLC
KPEFQGPRCEQCKSGFHSYPNCQVCTCDPRTSLDSGCTASGHCHCQPNYSGVSCDQCAPG
YYSYPSCTPCQCSAEGSRYISCDQVTGQCVCLSTVAGLRCDSCAHGAYGFPNCRAGTCHP
SGSVQYTVPPPVGQCECRRYVEGPACDKCKALYWNLSPDTADGCTNCECNIAGTISGVAE
CAQATGQCHCKPNACSGTCSSCKEGYYNLQEHNYFGCQGCQCDIGGSAGQSCGERNGRCL
CRPNVEGQKCNLPRPDHYFPDLHHLKFEIEEGTMLDDRPVRFGYNPVEFPDFSWRGYAQM
SPVQSKVLVSVSVSSPDLFHVVLRYANRRGSDVRGRVSVIDEAMNYYCGNCSEQSKQIVF
APSMEPTFVNVPQNTFVEPFVLNPGTWTVVIEAEGILLQDYLVLLPSAYYEAPILQIRVT
EPCFYSSVPEASHNCLQYRYLSLDSFPSISGNGASCRNDNHLPRPCPTEKVTARHPDMAV
CSGYDISVELRGRLSSAGNYVLVVEYSSEEEMPQTLSVTVNMAGARAHEHHVTLQHCKYS
FLCRAVAIDGQNRAAVFSLPADAEIQLSADRASFFLHKVYLVPKGEFTMEYVKPKIHCIS
THGQFSPDSSSCIPSRFQMPSDSLVLKEGQSSSMQEPVQASPAAAPPLPSYQSYKPTWTG
GERPPYGADNGDHIRLDSVQNAAVYSTRVHTLGRYVFILHYHQPLHPNYPVQVYINAGRI
WQGQANASFCPHAYGCRNVLVSENQIILDVTDHEVFLTVQIPAGKTLWLDYVLVVPESSY
SSNSLNEEPLDKSYDFISNCGQTSFYINPTTASQFCLGSAVSLSAFFNNGAMPCACHEVG
AESDTCEQFGGQCRCRPNVIGRDCSMCATGFWGFPNCRPCNCGTRLCEPVTGDCICPPRT
VLPECTQCEPQTFGCHPLVGCEVCNCSRPGISSPDVNCDTFSGQCRCKDNVVGRQCDRCS
PGFYGYPNCRPCNCNEAGTEEEVCDSFTGQCLCKENVQGSRCDQCRLGTFHLDPTNPKGC
TSCFCFGATDRCRSSDKRRKEVMDMEGWVLLGADRQEVPVVLYPGQDLVEADLSDVPDVY
QDIHWHAPKTYLGDKVSSYGGYLRYRLHTQTMRGDVLSLPAEASRPDIILKGNQMTLVFM
EREYSSPEEPHLGIVHMVEGSFRHAQTGNSVSREELMMVLVRLESLQIRAIHSQSAHSVS
LRGAVLEAAENLPAGRHANNVEICMCPANYMGDSCQKCAPGYYRDTIGLFLGKCVPCNCN
GHSDQCVDGSGICSNCQHNTAGDHCEICQGGFLGNNSLDGQAVACSSCPCPLRVASNNFA
EGCVQKTDRMQCLCMPGYAGPHCERCAPGYYGNPMVLGSRCQLCHCHGNTDPNMLFTDCH
PLTGECLSCMHNTGGPHCDICAPGYYGDAVTAKNCTKCNCSPCGTESCDPQTGQCRCKAG
VTGPSCDRCEVGSFGFELCSGCRHCDCDASAALVQPCNPQSGRCACQPGVNGPNCKQCAP
GYWDYGPNGCKKCSCRGGRCDPRSGECRCPDGMTGKQCDTCKQKYSVTVEHHDGVHCEPC
DSCVIVLLEDLDKLSEDFNSVAAQLSSLNASSMAWAQLRSLNKSVEEVTTAIENYNSTLD
DSRSRADRLDAEIMNINDDIDDLHGKATVLTDRVGDLQDRTNNTHQRAQDLLSFIHNMTM
DLKDVTMMANRTSLNDTEAEQDDGERERKMREVQAMLREMRYRSCVGQKRLADEEKTAAQ
ELLDRVNEELAGRQGENSDLASAIRERLARFHSQMMDLRDALNEAVNNTAVAAEINNINE
KTLEDNQRKIEDLLSKRKEVIDQLSMAEDDVAQVNDVLSMLHDSKEEYERLAAQLDGARM
PLAKKVQNFALVDSKIPLVEEAEKHAELLNTLAMNLSSVIAETKKEGIVDVTQSYNKIIN
SIKEAEEAANMAYKAANDTMENIKDQNLGQMADSLRNHSVELKDEVENLNDELNNELKPQ
LEDAQRRVDEAKTKQLDVMEDLAAVQNNLNFTTKTDASQEINEAKQAADLANTTATRVND
ALRPIKEQLDEWEQTYGDANSTNDDINNVLMEANKTVNALGESIPLLMKKLDKLQNQSVL
MPNISENISRIRQLIQQARNAASKVSVSMKFNGSSSVQVRTPRNLADLAAYTSLKFYITL
PEPSRSRRQDDSDQQFIFYLGNKDSSKEYLGLVLVGKKLEWYFNVGGETAAVLMPEDVMS
DGNFNSVVLERILQYGQMSMSSEASQGDLRVTKAYVEAVGDQGLLNLLTDDTVFFVGGYP
SSFKPPTPLVLPFFKGCIELDTLNEEVLSLYNFENTFQLNTTAEKPYGRSKPVATQPWVN
DAAYFDGTGFAEITMSGESTSVQRFEQEVKLISHKGILLLLHKENNFLCLAVLGGRLKVL
YDFSGELMELEPKDPSSEFLMISDADPKALEIIIVRSNNRMVVRNNRIGLYNHEFTEGIP
EFSSSYYLGGVPEDMMPEKLKSVFSNRGAVKGCFRNVKALTSHIDLKRMKNSGVSFGCDS
DLLVAREAHFSGQSYLDLSLANIPTLRNNFYSSFGFRTGQKEGLMFYHHDQCQVLLQEGH
VVVRAGPNEIRTQKTYNDDNSHYVALYNNINGMRLYVDDVLEKANEGGLTGSRVRSVTTT
EGSTFLGGMPNQRLANLTGCISNVFIRSEKNAQTVLNLLKVKENVNVPLTCPAAKKPQQI
VAARPKNSNKSKGKKKQPAGSRSRNTRESCRGEPSDREAGATHFSGSTHSYQRYNSLPGS
LASMPQISMAVRINSSDGLVLYAAGGKRGAAVMSLSVSDGHLLLLLDGGKRKVSLRSRKK
YNDNQWHTVFIRRQGEKISLVVDGISAQSKRIPGGDATRLAGPLYVGGVPPSLRAPGSGG
FAGCVRDLTLNEARAGTPTHSQGTVPCFQSPLQPGAYFSGQGGHMAIDEALVLGRDLEIQ
LEVRPVLDSGLLFHAGISPDQRLSLVLKQGEVTVSFNSGKGEFSTSFTPEEPLCNGRWHT
ITVVKKNNVLQLHVDEDTQHSVGPKQSRSAGSKETVYLGGVPDGVTVPGLPAGLPAFHGC
VRAATINRRPAMLSKPLAVHGAVGTQGCPH
Download sequence
Identical sequences G3P856
69293.ENSGACP00000013780 ENSGACP00000013780 ENSGACP00000013780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]