SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013929 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013929
Domain Number 1 Region: 3948-4087
Classification Level Classification E-value
Superfamily CalX-like 6.41e-29
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 2 Region: 4420-4567
Classification Level Classification E-value
Superfamily CalX-like 1.31e-28
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1723-1811,1839-1871
Classification Level Classification E-value
Superfamily CalX-like 1.96e-28
Family CalX-beta domain 0.00053
Further Details:      
 
Domain Number 4 Region: 2230-2383
Classification Level Classification E-value
Superfamily CalX-like 1.96e-28
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 5 Region: 4282-4424
Classification Level Classification E-value
Superfamily CalX-like 3.53e-28
Family CalX-beta domain 0.00056
Further Details:      
 
Domain Number 6 Region: 2116-2243
Classification Level Classification E-value
Superfamily CalX-like 1.14e-25
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 7 Region: 4064-4204
Classification Level Classification E-value
Superfamily CalX-like 2.22e-23
Family CalX-beta domain 0.0042
Further Details:      
 
Domain Number 8 Region: 3062-3225
Classification Level Classification E-value
Superfamily CalX-like 3.87e-23
Family CalX-beta domain 0.0067
Further Details:      
 
Domain Number 9 Region: 424-559
Classification Level Classification E-value
Superfamily CalX-like 2.88e-22
Family CalX-beta domain 0.0034
Further Details:      
 
Domain Number 10 Region: 1010-1136
Classification Level Classification E-value
Superfamily CalX-like 1.96e-21
Family CalX-beta domain 0.0029
Further Details:      
 
Domain Number 11 Region: 1308-1499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-21
Family Trypanosoma sialidase, C-terminal domain 0.079
Further Details:      
 
Domain Number 12 Region: 158-292
Classification Level Classification E-value
Superfamily CalX-like 6.28e-21
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 13 Region: 1134-1287
Classification Level Classification E-value
Superfamily CalX-like 8.37e-21
Family CalX-beta domain 0.0035
Further Details:      
 
Domain Number 14 Region: 3595-3682
Classification Level Classification E-value
Superfamily CalX-like 6.28e-20
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 15 Region: 1879-2010
Classification Level Classification E-value
Superfamily CalX-like 1.05e-19
Family CalX-beta domain 0.0048
Further Details:      
 
Domain Number 16 Region: 786-907
Classification Level Classification E-value
Superfamily CalX-like 1.07e-19
Family CalX-beta domain 0.007
Further Details:      
 
Domain Number 17 Region: 3789-3925
Classification Level Classification E-value
Superfamily CalX-like 1.19e-19
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 18 Region: 2600-2719
Classification Level Classification E-value
Superfamily CalX-like 1.57e-19
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 19 Region: 4676-4790
Classification Level Classification E-value
Superfamily CalX-like 5.89e-19
Family CalX-beta domain 0.0046
Further Details:      
 
Domain Number 20 Region: 5028-5199
Classification Level Classification E-value
Superfamily CalX-like 6.15e-19
Family CalX-beta domain 0.00067
Further Details:      
 
Domain Number 21 Region: 907-1009
Classification Level Classification E-value
Superfamily CalX-like 1.57e-17
Family CalX-beta domain 0.0076
Further Details:      
 
Domain Number 22 Region: 1986-2128
Classification Level Classification E-value
Superfamily CalX-like 2.75e-17
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 23 Region: 3684-3805
Classification Level Classification E-value
Superfamily CalX-like 6.41e-17
Family CalX-beta domain 0.0064
Further Details:      
 
Domain Number 24 Region: 5176-5314
Classification Level Classification E-value
Superfamily CalX-like 9.02e-17
Family CalX-beta domain 0.0061
Further Details:      
 
Domain Number 25 Region: 1589-1714
Classification Level Classification E-value
Superfamily CalX-like 9.55e-17
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 26 Region: 4187-4292
Classification Level Classification E-value
Superfamily CalX-like 1.05e-16
Family CalX-beta domain 0.0041
Further Details:      
 
Domain Number 27 Region: 41-164
Classification Level Classification E-value
Superfamily CalX-like 1.24e-16
Family CalX-beta domain 0.0035
Further Details:      
 
Domain Number 28 Region: 269-406
Classification Level Classification E-value
Superfamily CalX-like 1.96e-16
Family CalX-beta domain 0.0053
Further Details:      
 
Domain Number 29 Region: 2826-2934
Classification Level Classification E-value
Superfamily CalX-like 9.42e-16
Family CalX-beta domain 0.0038
Further Details:      
 
Domain Number 30 Region: 2347-2392,2494-2572
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000445
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 31 Region: 659-788
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000811
Family CalX-beta domain 0.0052
Further Details:      
 
Domain Number 32 Region: 2707-2839
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000051
Family CalX-beta domain 0.0039
Further Details:      
 
Domain Number 33 Region: 1260-1295,1502-1574
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000654
Family CalX-beta domain 0.0053
Further Details:      
 
Domain Number 34 Region: 4779-4906
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000549
Family CalX-beta domain 0.0039
Further Details:      
 
Domain Number 35 Region: 5452-5574
Classification Level Classification E-value
Superfamily CalX-like 0.000000000288
Family CalX-beta domain 0.0054
Further Details:      
 
Domain Number 36 Region: 4553-4665
Classification Level Classification E-value
Superfamily CalX-like 0.000000157
Family CalX-beta domain 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013929
Domain Number - Region: 4929-5006
Classification Level Classification E-value
Superfamily CalX-like 0.00876
Family CalX-beta domain 0.01
Further Details:      
 
Domain Number - Region: 523-651
Classification Level Classification E-value
Superfamily CalX-like 0.00968
Family CalX-beta domain 0.013
Further Details:      
 
Domain Number - Region: 2992-3041
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0713
Family C-type lectin domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013929   Gene: ENSGACG00000010487   Transcript: ENSGACT00000013954
Sequence length 6236
Comment pep:novel group:BROADS1:groupXIII:11410099:11489581:-1 gene:ENSGACG00000010487 transcript:ENSGACT00000013954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIFTVFSPFSTGMLPVFLLAGLILALSIPGTTSESATLRFLGQTDFVVNESNTAVIRLV
VERVGDPVNVTALILLEGVNTGDFESVNAAAFLLSTESNKTIFIAVRDDDLPEADETFTF
NLILQSSSNGITLGKPNKATITILSNDNAFGIVGFNSTEDIVVEEPRGRNHYVPFTLTRE
KGTYGTVNVNFEISEGPNPAIEDLSPDRGNITIPVGQSVVNFRILITDDEIPEDDEVFSV
RLTAVAGGALLRPNASSVQLRIRRNDSPLRFSHSIMAVPESAGIIALNVTRGRLTEDGPL
IGSVDTEVSVEYMVVSSRGQGSATPAVDFLDLQSSRTVIFPPFVYKTSLFFNISDDIVPE
IAESFHLILLEESVRGDAVLVPPNAVQVTIEPNDKPNGVLSISSSAAIQPIIINEDLIQR
FEGIVIVRNGGSYGAVSANWSISRNSSDRSPVSDDLKPAEGTVRFAAGQVTAVIPINIVA
DDLPEEAEAFVFKLLNNTSTGNAEVDEPTEIVFYIQDSDDVYGLFRFDPAKEQSIHSQPE
GRFLSLNFLREGGTLGDVSMALTALYIPAGPIDPALAGDQVLNTSRSVNVVFSRKRMVPV
ILPIRNDAFLQNGAHFLIQVNTLELVQISPPIQSNSPRFGGPLNLTLTVTPDIANGEIGF
TSNTTVVLFEPEDNNTSRVSLPLRRDGTDGQAEVFWSLQPIGDNIVAVTVNDLGPLSGSV
VFLSGQSDASINFTIMADNIPEVNETLLLTLDRSNVKNQILKAGFTSREIVIMENDDPGG
VFEFSSFSRGPLFINEGDTVELHVVRAQGQLLKQLVRYAVMPVGNTEFYGATGILEFLPG
EKDLVVTLIARPDEVPEMDETFSVVLSSHSTPPSRLGNYREVNITVRKNDDPFGVIEFIQ
SGLTVAINESKGDKMHGAVFPVVRNRGNFGEVSVSWVLEPARSGDVSPLQGNITFMERQY
LNNLTLFSIPDEIPENMENFTITLLNATGGARLGNILHANLQINKNDDPIYFSEPVVVRL
QEGGVANFTVLRAGRMDFVATVMYRVEYREASPGDIAVLSNDTLLVYDVGEWMKNISVAV
EDDNIPETDEPFNIVLYNATGDVVVYGANTATVVIEANDDANGIFFLEAIEKPVEEGKTN
NVYILRSRGHFGNVTVFWQLFANDSVTPLEENQEFTNTSGSINFKTGEETKPIVLEAISD
KLPEFNEFFVLRLVNISGGYPGEGGQLAKTSLTASILIPFNDDPFGVFSITDNNLDQEIA
EDVVSEDDMADVTSFTILRQQGTFGDVRVAWEIVSGRFPEGLPLMDDLLLLASFPDEVEL
RPHAKRHHSATDTWYFSGLPGAYGNISPKDGPAAVGNFTFSAWLVPGPDTDGFIVCKGSK
NGTLYYGVKVQTNESHVMVMLYYTVIGSNNTQVARATAEKFVENNSWLHVIITVDDGIIE
FFLDGNPIPGGLKSIKGEGIADGPASVFIGSDPQGEQRFTGLLQDVRLYSTKLNRSHIHE
LHTQPAKADLRNISGFLRYRQDERQKSFVVEARDDEEEEGEEVFYLQLVAVQGGARLPFP
RPTATLRVLKSDNANGLFGFTGACIPDTSEEGSTISCVIERTRGSLDQVFVNYSVTQLDS
ETPAHQDFVNSTGAVFFSPGKRSLGVLNLLVLNDNLPELAESFLITLVSAESGDGKQGST
PTSGASIDPANSVNNVTVTASDHPYGLLQFQPIPQGEGLIPPALEPAHITVNEEDGQIHL
LVARAQGLLGRVMVGYRTTPFTASSPEDYEDSEGVLDFLPGERLKFINVTIIDNPVPELD
KIFRVELYNTEGGVDQFLRSEGSGSGESDSDFLLPSFHHCASLGAASRITVTIAASDDAH
GVFQFSPESLTVNGTEPEDGRSSVVLQVDRAFGDLSNVTVYWEADPSSEGELLSRFGNIT
FGVGQTSENIIINVAQDEISELDSSVSVSLVNVTHGRLGVQTSATLTVLANDDPYGVFVF
ANKTRSVRLPEAYSTVTLIILRQRGLMGQVRVTYGTLKEGDPEPYSTPGLGRATEGRDFV
PLLDSVVFLANQSEANITIQVLDDEDPERDESVFVVLISVQLITGEQERLISNSPSLGLR
ADIVAQVIVEASDDAFGILQLSASAVSVAEHYVGPIINVTRVGGIFADVSVKFRAMPLTA
RVSEDYSVASTDVVLLEGESSKSVPVYVINDIVPELEETFLIELINQTTGGALLGELRRA
IITILPSDDPFGAFVFQAVPVTIEEPGSNSMEVKLPIVRNAGTIGTVVVQWQATVNGKLA
VGDIRPTSGEITFAPGETMKILQVEILADDVPETTEIIMVELIGASNGGSLGVDRSVNVI
VPDNDNPYGTVYFEQTVYRFQEPLQGVYRANITVHRRGGHFGRLEIVYSTSEVDIVGLAQ
ADGQNLLMYYNTPKPGVPSTAPGRTVNITGQSDALAACAAACLREQACKAFCLSSRETLP
SCTWVTSGVDQLTPQAQVMTYVKNVTAAAVLFSTQAVAGSDYSPVTAQRAFMEDGSGVAN
LTVPILTDTFPEMDESFSIHILKVELINLTVAQKNLPSIGLPDKAVVTIGMNGDAFGVFL
IYSLSPNTTNEGLYLEVREEPMVVVPLVIERRGGNLGIVTIEWRFVGGKGTPDADFSGTG
GILVFNDYLSTGDLKKTIEILIRDDIVPEDNETIMIGLVNTEGGSRILPNSDTVTIVILA
NDYVAGIVGFHPASRSVISRKGGERLSLLVTRTAPGLGNITVDWNVKGPLVHQTFPKISG
TLYFAEGELNDTIVLQLLDDATPEDKDEYKVSLSNIQTFGVVVTGHAALDVQGSEAVLTV
DTSDEPYGLLTIAPSSLRVTTEERDQTINIYVNREFGASGAVNITYEVIRGSLQDMSLVE
GSLAEPGQDFISGSSSVILQDGQTSVAIPVTILEDNIPELQEFFLVNITSAVLITTLATV
PKLGMDTFKRGVDLDCQQSIQDIINQSSNRLCCSAIQATYSLTLHRFAQMNLDGQLHFGL
NLRYYITSGYTRTPCCVMLLIQRHALQWNNKLCTMIQKFVCNLSIYSGSSSVNILASDDG
HGVISFNTSEHFLLREPTSVSGLSESVATLYVVRNPEKGTFGTVTVQFTITDANGSLAEG
DLMPAQGFVVLEDGAKFKMLEIRAVLDAEPEVNETFTVTLSSPTGGARMGHQLKSLITIL
ENLAPSGLFRIGPSINRTNTKVIAEEGGMAVFLTVSRSNGLESSVSVEWEMQSDSAIASE
GHLPVMGVYQNFEDNPTSSWCSLPEGPSSLAMRLDKRPVAGSSLTVATLYRWQGVLVPVE
SIRIQDPSSCVGFAVNGSTYIAITHGGPPFYPAANLSIFKMQMDLNMTLEQTLGVEALNV
KHFATEGRDYLIASSQKCQSSLIPLHLFCVIPQIFVRTGGFFALHQTLNNEEDILSVTPF
ARAAVPYLLVCIDRQTVSCLLLQWTSGRFQDAQPLPLAGRAIHVETINTRAENTLLFAAV
EGVPAFLYLSLGPSPSCVVFQWSSGQPFPQLSQSIPHPGLTSIHPFTSSGITYVLLAGRN
GSSLYSWRSDVNLLVMVLRAPPAFSFFSLLVTSLNTNKTLLASNEESSSSVYQFTSVSNQ
SDFIPSFGELHFGPGDSELEIAVNIIDDDIPEEQEYFHVSLKNPKGGAEIGFGGHVTVFV
PTNDDAHGVIGFAQNSLSVEVEELEQNNQISLSMERKRGTFGRLTVHWAANGSLADIYPT
SGVVIFSEGQSVANISLTVIADGVPELRESVTITLVDVTTVGLQDLRQAAVIDKQRALAL
LTIRPNGSPYGIIGWHPNSQLTLTQEPQRVPVNVTLSIVREQGSSGEVEIHYQTRPPLYK
PPSNQASPGQDYISKDNTIIMMNGATVALVTVTILPDDVPELAESFLVNITSVELVSGSM
GGGQPSVKRPGMEVAEVTIQENDDPRGILQFNMSKDITGSVLAFEIPPPDNILHLSVIRL
AGTTGRLVLYWEALPGTADVDDFRPSFGNITFQDGQTTATIAITISDDERVEILETFRVN
LLRVIGGARLGDATSVNISIPANDSPLGQFGFQELEVTVSEPQFVDDPAALATLSVLRSP
GGKGTVTLGWQLQDKARDDLSPFNGTLVFNEAQSMKSFMIRALADTILEGTEYFRVQLFP
AESGAIIDPLKGTATITIRADKAALGIIGIEESSGTILIGEPQGDYNGSAVVRLVRGPGV
FGEVQVYWNITPAVVSEFEVISGTVTMKDGQSFATIILKALDDDLPEERREYQLTLTSAT
AGMEISSTAKHAKIIMAASDNPYGLFSFTQQQIRVSEEEGMVNVTINRSLGSLGSVWVTF
HTSGNTAVSGVDFAPSSGRLLFPPGQTSQQVTLHVLDDSLAEDTEMFFLNITEVELPSFN
VDLTVKNSGLELDQPPAIGNISSVAVVILKNDNAEGILEFRQDYVNITVAEDVGTLLIPV
VRRAGSYGIVSAQFTSRGLSATPDFDYILNNGSAKFLYGQNTSYINLTIIDDLDSEYEEV
FEVRLVGATGGAVLGSQQVARVTIAKSDSPNGVIRFLNQSLITLANPNSTLKVLLLLERA
GGLVGNATVAWKILGPNSREVLSPLNKDIREPVNGSFFFRDGDEGTQVMELRILPHGEVE
VEETFVVELSILSGEVDVDSQAGSITLKIEKFGDPNGIVQFTDDALQERVYNESTEAEGP
FNISLYVTRREGVMGNITVRWRIQSDSDIVGDFLALGGSVMILEGQRDAEIVLSLMPDTV
PELEEFYTVQLTAVEGGATLDANQNQIRTLIRVRANDEPYGVFSLNPKQQSIMIVESESQ
ITRVLVMNVTRLAGLFGDTIVSYRISGGIDEVMDIREILRGQDEGTLTFREGQTFSTISV
PINSQVFLSVGESFTAELTNVRLVGPIHGSLPRLLQGANIATVTVPEEAASSEVGFASLV
LHVSSIETGACEAKVTRRGLFGEVRVQWKAGYPSGQAPLGLSPGAISPSSGSLTLVHGEK
TKAISLTAVADAFEPASYAIHLTAATSSSSAASAVKLRAGFTVTEVEPLGIYQFTPDSRQ
LVIAEDIQTITLYVQRLYGSRSNSTRLSYTTLAGTAAAGEDFIAVPDGSLVFNSPLQTNT
SFRLSILDDSLSEADENFHVNLTDVQVLTPDVAWADASPRLNLQHSVATVTIQASDVTGG
VLSIGPGLVKIPEDRAEETQQEQRVVLRVRRSESVAGAVTVRVQAYGGACLFLYATPIPF
TLDPVETLAKEEQDFRLESTVVSFQAGQNETEIVLFIVDDREPEGQEVFFIYLSDPEGGA
QITDSPYQGFGAFAKITILGSDFHNGIIGFTLNSQLGQVLDEDSKNRTAILFLQRQENRA
FEDLQVFWRVTLSKAVLTLVNNEVNLTRQLLQTSGTALCRRREILCALAVEVQDDEVRVM
QRPLFIRVGAGAAINETTRFGQHHVGESDDPQGIMYFAAGHRLPVATLTTMRLSLQVYRR
ASTASVISVQYRTLELPREDAVGPSTIWPAKAGMDFPKQEGRLTFNVGQRNTSLDIYLTP
DLASTLPTPKRFQVELYNATGGTRVHSLFGVANVTLVSNAASEAVWLILDQLYQPLDSTI
LNQVLQGLINKVSTAVNHEQMVAVLEAMGKVIAEAERAPIEESSRNLTYNLLCSLANPSR
SDTRGLTYLAEVAERFAFSLLAQIQCEMRGTILETCPYMSISAFQWYPTQINAHKFRGRN
ADFFQLPDTLLAVPAVSTPNCGNLSQIQLTEFRTEHWFLTNDTNTALNGKVFSASLQDRR
SRPLHDDNEVVYRIHSPGQQVKPGRSRCLLWNQTTASWSSDGQYCRVLKESGNYVECACS
HLSIYTAYAEFVTPASYNNAFYASGFISVSGFALAIISHVLCSRFPMFSAKLLTHMMVSC
LGTQICFLVSAFRGRMFSDDSCATLALFSHYFHLSQFFWMLIQAVNFWQVLVMNDEHTER
RYLLYFLLAWGLPALVIIVLVVVLLGGFGWTIHTVYGLVQGDVCFIPNIYAALCTAVLVP
LICLVAVMVVFIHAYQVTQQWKAYDDIYRGRTNSTEVPLVLYLFLLISLVWLWAGLHMAY
RDLWMLILYVIFNCLLGLYVFAVYFVMHNQLCWPTKASYTVEMSGHDSPDSTYQGGGPTT
VGGDISKSTQNLISAMEEVSADWERASLQPGSHPSSVFKPSPVMGTYSTEGGFINSNLVT
ADEESQEFDDLIFALKTGTGLNLSDNESLPGSHDGGSINNSQIVELRRIPIADTHL
Download sequence
Identical sequences G3P8K5
ENSGACP00000013929 69293.ENSGACP00000013929 ENSGACP00000013929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]