SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014121 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000014121
Domain Number - Region: 166-225
Classification Level Classification E-value
Superfamily TIMP-like 0.00294
Family Tissue inhibitor of metalloproteinases, TIMP 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014121   Gene: ENSGACG00000010662   Transcript: ENSGACT00000014146
Sequence length 289
Comment pep:novel group:BROADS1:groupXI:8418125:8424247:1 gene:ENSGACG00000010662 transcript:ENSGACT00000014146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAPMPASLLPPLLLLLCRSAFCQYSSDQCSWKGSGLTHEGHARDVEQVYLRCSQGSLEW
LYPTGAIIVNLRPNTLSAAAARLSVCIKPLAESSGTNIYLDRNGKLRLLLRDQDQARGKV
QCFGIQEGALFIEAIAHTDISRRTTAFQYELVSDRLGPQARRAGGAPCQPCSDAEVLLAV
CTNDFVARGSIEKVEEEEERSSVTVELRRLYRQKTQVFAPGGVRVRRWTGHIKMSPQCAV
RSGEGEFLFTGTVRFGEAWMGCAPRYKDFLRLYGEAQRQGTNPCHMDTD
Download sequence
Identical sequences G3P947
69293.ENSGACP00000014121 ENSGACP00000014121 ENSGACP00000014121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]