SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014225 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014225
Domain Number 1 Region: 232-494
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-87
Family Protein kinases, catalytic subunit 0.00000000058
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014225
Domain Number - Region: 77-132
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0759
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014225   Gene: ENSGACG00000010731   Transcript: ENSGACT00000014250
Sequence length 498
Comment pep:novel group:BROADS1:groupXV:9799234:9803821:-1 gene:ENSGACG00000010731 transcript:ENSGACT00000014250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDSGVCEDKPPAPPVRMSSQGGGAKDPQSANHSSRPLPSVPEERKSRNKIISMFASEKG
GRKKDRDKDRPEISSPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNISKSEQKQNPQ
AVLDILKFYDSTSGKQKYLSFSASDKDSQSPGKQGTAASQSGGKDGDDDDDDDTPPPVVA
PRPEHTKSVYTRSVIDPLPASEVDGASKAADRQKKKGGKMTDEEIMEKLRTIVSIGDPKK
KYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKEMKNPNIV
NFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHR
DIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIW
SLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLSPVFRSFLSRCLEMDVEK
RGSGRELLQHPFLKLAIP
Download sequence
Identical sequences G3P9F1
ENSGACP00000014225 69293.ENSGACP00000014225 ENSGACP00000014225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]